BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00154 (772 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) 161 4e-40 SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9) 36 0.027 SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) 31 1.0 SB_5097| Best HMM Match : GARS_A (HMM E-Value=0) 31 1.0 SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) 31 1.4 SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) 29 3.1 SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) 29 4.2 SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) 29 4.2 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_51602| Best HMM Match : Glyco_hydro_38C (HMM E-Value=1.1e-31) 29 4.2 SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 4.2 SB_7014| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_59749| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_56796| Best HMM Match : CITED (HMM E-Value=1.2) 28 7.3 SB_53228| Best HMM Match : CITED (HMM E-Value=2.5) 28 7.3 SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) 28 7.3 SB_15117| Best HMM Match : Pox_A32 (HMM E-Value=0.038) 28 7.3 SB_10611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_1260| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.3) 28 7.3 SB_58633| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=2.8) 28 7.3 SB_37846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_19127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_9870| Best HMM Match : GspM (HMM E-Value=1.9) 28 7.3 SB_5898| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 28 9.6 SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) Length = 240 Score = 161 bits (392), Expect = 4e-40 Identities = 76/81 (93%), Positives = 80/81 (98%) Frame = +3 Query: 258 SVELYAEKVATRGLCAIAQAESLRYKLIGGLAVRRACYGVLRFIMESGARGCEVVVSGKL 437 SVELYAEKVATRGLCAIAQ ESLRYKLIGGLAVRRACYGVLRFIMESGA+GCEVVVSGKL Sbjct: 83 SVELYAEKVATRGLCAIAQCESLRYKLIGGLAVRRACYGVLRFIMESGAKGCEVVVSGKL 142 Query: 438 RGQRAKSMKFVDGLMIHSGDP 500 RGQRAKSMKFVDGLM+H+G+P Sbjct: 143 RGQRAKSMKFVDGLMVHAGEP 163 Score = 143 bits (346), Expect = 2e-34 Identities = 69/77 (89%), Positives = 74/77 (96%) Frame = +1 Query: 25 ISKKRKFVGDGVFKAELNEFLTRELAEDGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGR 204 ISKKRKFV DG+FKAELNEFLTRELAEDGYSGVEVRVTPIR+EIII+ATRTQ+VLGEKGR Sbjct: 5 ISKKRKFVADGLFKAELNEFLTRELAEDGYSGVEVRVTPIRTEIIILATRTQNVLGEKGR 64 Query: 205 RIRELTSVVQKRFNIPD 255 RIRELTSVVQKRF P+ Sbjct: 65 RIRELTSVVQKRFGFPE 81 Score = 100 bits (240), Expect = 1e-21 Identities = 45/63 (71%), Positives = 49/63 (77%) Frame = +2 Query: 497 PLQ*YVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 676 P YV+TA RHV LRQGVLGIKVKIMLPWD GK GPKKP PD + + EPKDE VP +P Sbjct: 163 PTTHYVDTAVRHVYLRQGVLGIKVKIMLPWDPTGKTGPKKPLPDQVSIVEPKDEVVPAQP 222 Query: 677 TSE 685 TSE Sbjct: 223 TSE 225 >SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9) Length = 482 Score = 36.3 bits (80), Expect = 0.027 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 577 VAVGPARQERPEEATTRPHPGNRAQGRARA 666 VA GPAR PE TRPHPG GR A Sbjct: 107 VAAGPARITSPEPPATRPHPGRVEAGRRLA 136 >SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) Length = 301 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 589 PARQERPEEATTRPHPGNRAQGRARA 666 PAR PE TRPHPG GR A Sbjct: 42 PARVTSPEPPATRPHPGRVEAGRRLA 67 >SB_5097| Best HMM Match : GARS_A (HMM E-Value=0) Length = 893 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 399 GARGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDTSTLL 524 G G +V+ KL G+ + F DG I + P D TLL Sbjct: 183 GDAGSTIVIEEKLEGEEFSVLAFTDGKTIAAMPPAQDHKTLL 224 >SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) Length = 1115 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 589 PARQERPEEATTRPHPGNRAQGRARA 666 PAR PE TRPHPG GR A Sbjct: 537 PARITSPEPPATRPHPGRVEAGRRLA 562 >SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) Length = 1851 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 580 AVGPARQERPEEATTRPHPGNRAQGRA 660 A AR PE TRPHPG GRA Sbjct: 1497 AARDARITSPEPPATRPHPGRVEAGRA 1523 >SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 62 SRQNSMSSSLGSWPRTATPAWKCGSLPSARRSLLWPPGH-RVCSERKDAESVSSLP*Y 232 +R+ ++ +L + P T +CG + +AR L+ P H R + V SLP Y Sbjct: 272 TRKMMLTRALSTTPSTTPELRRCGGVLTAREGLIMSPNHPRPYPSDTHCKWVISLPSY 329 >SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) Length = 988 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 547 RSTRNQGQNHVAVGPA--RQERPEEATTRPHPGNRAQGRARA 666 + R + VA PA R PE TRPHPG GR A Sbjct: 801 KQRREPARTPVAALPAAARVTSPEPPATRPHPGRVEAGRRLA 842 >SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) Length = 401 Score = 29.1 bits (62), Expect = 4.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 428 WQAAWSTCQINEVCRWTHDPLW 493 W+ AW+ C + E +T++P W Sbjct: 76 WKQAWTPCSLQETTIYTNNPPW 97 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -1 Query: 742 ILSDSGDRLRQRRGREGAHFAGRLEGHGL 656 +LS +GD +R GRE HF + HGL Sbjct: 769 VLSSNGDFIRSFGGRESMHFRYCVYSHGL 797 >SB_51602| Best HMM Match : Glyco_hydro_38C (HMM E-Value=1.1e-31) Length = 976 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +2 Query: 422 CIWQAAWSTCQINEVCRWTHDPLWRP 499 C W + W + E WTH P RP Sbjct: 185 CRWLSQWKQSEEEESVLWTHSPARRP 210 >SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +2 Query: 287 YSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPFHHGIWCPW 409 Y+W L + P + ++ Y R + L C+P + W W Sbjct: 4 YNWWLAWNPALLCLMRQYNRWLAWNPALLCNPRQYNRWLAW 44 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.1 bits (62), Expect = 4.2 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +1 Query: 550 STRNQGQNHVAVGPARQERPEEATTRP 630 +++N + H + PA+QE+PE + +P Sbjct: 162 TSKNTSRTHKIIAPAKQEKPERYSRKP 188 >SB_7014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 589 PARQERPEEATTRPHPGNRAQGRARA 666 P R PE TRPHPG GR A Sbjct: 185 PPRITSPEPPATRPHPGRVEAGRRLA 210 >SB_59749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1091 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 580 AVGPARQERPEEATTRPHPGNRAQGRARA 666 A AR PE TRPHPG GR A Sbjct: 820 AARDARITSPEPPATRPHPGRVEAGRRLA 848 >SB_56796| Best HMM Match : CITED (HMM E-Value=1.2) Length = 431 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 580 AVGPARQERPEEATTRPHPGNRAQGRARA 666 A AR PE TRPHPG GR A Sbjct: 42 AARDARITSPEPPATRPHPGRVEAGRRLA 70 >SB_53228| Best HMM Match : CITED (HMM E-Value=2.5) Length = 417 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 580 AVGPARQERPEEATTRPHPGNRAQGRARA 666 A AR PE TRPHPG GR A Sbjct: 168 AARDARITSPEPPATRPHPGRVEAGRRLA 196 >SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) Length = 804 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 592 ARQERPEEATTRPHPGNRAQGRARA 666 AR PE TRPHPG GR A Sbjct: 604 ARVTSPEPPATRPHPGRVEAGRRLA 628 >SB_15117| Best HMM Match : Pox_A32 (HMM E-Value=0.038) Length = 771 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 580 AVGPARQERPEEATTRPHPGNRAQGRARA 666 A AR PE TRPHPG GR A Sbjct: 386 AARDARITSPEPPATRPHPGRVEAGRRLA 414 >SB_10611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 604 RPEEATTRPHPGNRAQGRARA 666 RPE TRPHPG GR A Sbjct: 546 RPEPPATRPHPGRVEAGRRLA 566 >SB_1260| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.3) Length = 220 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 580 AVGPARQERPEEATTRPHPGNRAQGRARA 666 A AR PE TRPHPG GR A Sbjct: 42 AARDARITSPEPPATRPHPGRVEAGRRLA 70 >SB_58633| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=2.8) Length = 599 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 580 AVGPARQERPEEATTRPHPGNRAQGRARA 666 A AR PE TRPHPG GR A Sbjct: 425 AARDARITSPEPPATRPHPGRVEAGRRLA 453 >SB_37846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 580 AVGPARQERPEEATTRPHPGNRAQGRARA 666 A AR PE TRPHPG GR A Sbjct: 284 AARDARITSPEPPATRPHPGRVEAGRRLA 312 >SB_19127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1492 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 592 ARQERPEEATTRPHPGNRAQGRARA 666 AR PE TRPHPG GR A Sbjct: 1351 ARITSPEPPATRPHPGRVGAGRRLA 1375 >SB_9870| Best HMM Match : GspM (HMM E-Value=1.9) Length = 522 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 592 ARQERPEEATTRPHPGNRAQGRARA 666 AR PE TRPHPG GR A Sbjct: 181 ARVTSPEPPATRPHPGRVEAGRRLA 205 >SB_5898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 580 AVGPARQERPEEATTRPHPGNRAQGRARA 666 A AR PE TRPHPG GR A Sbjct: 781 AAHDARITSPEPPATRPHPGRVEAGRRLA 809 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -2 Query: 684 SLVGSRGTGSSLGSVTRMWSGCGFFGPFLPCW 589 S+ S G GSSLGS+ R W P W Sbjct: 215 SIASSLGLGSSLGSMGRDWGRMSTNSPSFQSW 246 >SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 957 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 592 ARQERPEEATTRPHPGNRAQGRARA 666 AR PE TRPHPG GR A Sbjct: 792 ARITSPEPPATRPHPGRVEAGRRLA 816 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 27.9 bits (59), Expect = 9.6 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +2 Query: 557 GIKVKIMLPWDQQGKNGPKKPQ-PDHILVTEPKDEPVPLEPTSEVRS 694 G+K+K+ML D+ G + P P+ P P + P E S +S Sbjct: 1628 GLKIKLMLKKDRSGGSSPVSPRSPSPCEPRLPLESRSPFESNSSFQS 1674 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,950,274 Number of Sequences: 59808 Number of extensions: 522081 Number of successful extensions: 1754 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1748 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -