BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00153 (798 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 8.3 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 8.3 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 8.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 680 RCGGVCHHSDPTTSPSCP 627 R G HHS T P+CP Sbjct: 1248 RLDGPQHHSYATIGPNCP 1265 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.4 bits (48), Expect = 8.3 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 548 INHLGHSGYLNTVTVSPDGSLCASGGKDMKAM 643 INH G++ N SL +GG+ + M Sbjct: 63 INHQGNAASANVAVADRQQSLILAGGRRQRIM 94 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 944,042 Number of Sequences: 2352 Number of extensions: 20407 Number of successful extensions: 48 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -