BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00149 (660 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 122 1e-29 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 28 0.30 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 27 0.40 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 27 0.40 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 27 0.40 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 27 0.40 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 27 0.40 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 27 0.40 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 25 1.6 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 2.1 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 3.7 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 3.7 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 3.7 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 3.7 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 4.9 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 23 6.5 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 6.5 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 23 8.5 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 122 bits (293), Expect = 1e-29 Identities = 57/99 (57%), Positives = 70/99 (70%) Frame = +1 Query: 217 GCHLWQA*EPWCHQLKPTRNLQSIAEEXXXXXXXXXXXXSSYWVAQDSSYKYFEVILVDP 396 GC + +QLKP R LQS+AEE +SYWVAQD+++KYFEVI+VDP Sbjct: 78 GCTYGKPKSHGVNQLKPYRCLQSVAEERVGGRLGGLRVLNSYWVAQDAAHKYFEVIMVDP 137 Query: 397 SHKAISRDPKINWIVNAVHKHREMRGLTSAGRSSRGLAR 513 + AI RDP +NWI NAVHKHRE+RGLTSAG+SSRGL + Sbjct: 138 PNNAIRRDPNVNWICNAVHKHRELRGLTSAGKSSRGLGK 176 Score = 119 bits (287), Expect = 7e-29 Identities = 55/89 (61%), Positives = 61/89 (68%) Frame = +2 Query: 2 YIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGYXXXXXX 181 Y+QELYRKK SDVMR+LLRVR WQYRQ+TR HRAPRP RP + RRLGY+AK G+ Sbjct: 6 YVQELYRKKQSDVMRYLLRVRAWQYRQMTRFHRAPRPWRPTRLRRLGYKAKTGFSIFRIR 65 Query: 182 XXXXXXXXPVAKGATYGKHKSHGVTS*SP 268 PV KG TYGK KSHGV P Sbjct: 66 VRCGGRKRPVHKGCTYGKPKSHGVNQLKP 94 Score = 44.0 bits (99), Expect = 4e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +3 Query: 510 KGHRYSQTKGGSRRAAWLRRNTLQLRRKR 596 K +RYSQT GGSRRAA +RRN L LRR R Sbjct: 176 KAYRYSQTIGGSRRAAGVRRNRLHLRRYR 204 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 27.9 bits (59), Expect = 0.30 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSIH 287 V AAS LL V SI + S ++ HA P+IH Sbjct: 12 VAAASAGLLPVAHHGSIASSHSTIQHHAAPAIH 44 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 27.5 bits (58), Expect = 0.40 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSIH 287 V AAS LL V SI S ++ HA P+IH Sbjct: 12 VAAASAGLLPVAHHGSIATSHSTIQHHAAPAIH 44 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 27.5 bits (58), Expect = 0.40 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSIH 287 V AAS LL V SI S ++ HA P+IH Sbjct: 12 VAAASAGLLPVAHHGSIATSHSTIQHHAAPAIH 44 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 27.5 bits (58), Expect = 0.40 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSIH 287 V AAS LL V SI S ++ HA P+IH Sbjct: 12 VAAASAGLLPVAHHGSIATSHSTIQHHAAPAIH 44 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 27.5 bits (58), Expect = 0.40 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSIH 287 V AAS LL V SI S ++ HA P+IH Sbjct: 12 VAAASAGLLPVAHHGSIATSHSSIQHHAAPAIH 44 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 27.5 bits (58), Expect = 0.40 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSIH 287 V AAS LL V SI S ++ HA P+IH Sbjct: 12 VAAASAGLLPVAHHGSIATSHSTIQHHAAPAIH 44 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 27.5 bits (58), Expect = 0.40 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSIH 287 V AAS LL V SI S ++ HA P+IH Sbjct: 12 VAAASAGLLPVAHHGSIATSHSTIQHHAAPAIH 44 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 25.4 bits (53), Expect = 1.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +3 Query: 498 PRSRKGHRYSQTKGGSRRAAWLRRN 572 PR+ + H Y++ GG +R+A R++ Sbjct: 175 PRAERRHPYTRRSGGQQRSAGWRQS 199 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.0 bits (52), Expect = 2.1 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSI 284 V AAS LL V SI S ++ HA+P+I Sbjct: 12 VAAASAGLLPVAHHGSIATSHSTIQHHARPAI 43 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 24.2 bits (50), Expect = 3.7 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSI 284 V AAS LL V SI S ++ HA P+I Sbjct: 12 VAAASAGLLPVAHHGSIATSHSTIQHHAAPAI 43 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 3.7 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSI 284 V AAS LL V SI S ++ HA P+I Sbjct: 12 VAAASAGLLPVAHHGSIATSHSTIQHHAAPTI 43 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 24.2 bits (50), Expect = 3.7 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSI 284 V AAS LL V SI S ++ HA P+I Sbjct: 12 VAAASAGLLPVAHHGSIATSHSTIQHHAAPAI 43 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 24.2 bits (50), Expect = 3.7 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 189 VVAASVQLLRVPLMASIRAMVSPVEAHAQPSI 284 V AAS LL V SI S ++ HA P+I Sbjct: 12 VAAASAGLLPVAHHGSIATSHSTIQHHAAPTI 43 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +1 Query: 418 DPKINWIVNAVHKHREMRGLTSAGRSSRGLARDIDTL 528 + ++ WIV+ +KH + + S+G DI +L Sbjct: 588 ETELGWIVSGAYKHNNLNQSMACTIVSQGGENDIASL 624 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 487 GRSSRGLARDIDTLKQREAHAGQLGSDAT 573 GR+S+G + T+K + + G +G + T Sbjct: 231 GRTSKGFKSEWATVKDQVLYVGSMGKEWT 259 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 6.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 501 RSRKGHRYSQTKGGSRRAAWLRRNTLQL 584 R + RY++T+ +RRAA +R +L Sbjct: 1051 RQERLRRYNETRNAARRAATQQRQAERL 1078 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 109 PGSAVHTSQLTVLPYPHTQQKTH 41 PGS +SQ + + H QQ+ H Sbjct: 14 PGSGASSSQRSPFHHHHQQQQNH 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,737 Number of Sequences: 2352 Number of extensions: 13395 Number of successful extensions: 58 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -