BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00148 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68295-1|CAA92587.1| 325|Caenorhabditis elegans Hypothetical pr... 29 2.4 U53139-9|AAW88402.1| 379|Caenorhabditis elegans Serpentine rece... 27 9.8 U53139-8|AAK18938.3| 338|Caenorhabditis elegans Serpentine rece... 27 9.8 >Z68295-1|CAA92587.1| 325|Caenorhabditis elegans Hypothetical protein C07C7.1 protein. Length = 325 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/61 (24%), Positives = 28/61 (45%) Frame = -2 Query: 204 PGIPEISRNKQTERQTKIVKNVILVYVPYIYSYMHVVKRGYFNITNRHSNLIYMYRFYND 25 P +P NK ++KI V+L+ +P++ + + F I H N Y Y ++ Sbjct: 72 PFLPTQKNNKILNSESKIFAFVVLLLLPHLRLIIFQLFLVLFLIPRHHHNFCYFYSTHDG 131 Query: 24 E 22 + Sbjct: 132 Q 132 >U53139-9|AAW88402.1| 379|Caenorhabditis elegans Serpentine receptor, class w protein68, isoform b protein. Length = 379 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 25 VVIKSIHIN*IGVSVCNIEITSF-YYMHI*IYIRN 126 +V SIH+ IG+SVC++ + S Y H +RN Sbjct: 61 MVNNSIHVMMIGISVCDLLLMSLGVYGHFDFLLRN 95 >U53139-8|AAK18938.3| 338|Caenorhabditis elegans Serpentine receptor, class w protein68, isoform a protein. Length = 338 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 25 VVIKSIHIN*IGVSVCNIEITSF-YYMHI*IYIRN 126 +V SIH+ IG+SVC++ + S Y H +RN Sbjct: 61 MVNNSIHVMMIGISVCDLLLMSLGVYGHFDFLLRN 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,196,741 Number of Sequences: 27780 Number of extensions: 304443 Number of successful extensions: 711 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -