BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00147 (430 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 46 3e-04 UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Gr... 34 1.4 UniRef50_Q01E31 Cluster: Dual specificity phosphatase Cdc25; n=3... 33 3.3 UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12... 32 4.4 UniRef50_Q4TGD5 Cluster: Chromosome undetermined SCAF3766, whole... 32 5.8 UniRef50_Q0KIR5 Cluster: Putative uncharacterized protein; n=1; ... 32 5.8 UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1... 32 5.8 UniRef50_Q69YN4 Cluster: Protein KIAA1429; n=52; Euteleostomi|Re... 32 5.8 UniRef50_Q8GW81 Cluster: Putative uncharacterized protein At4g16... 31 7.7 UniRef50_Q7S728 Cluster: Putative uncharacterized protein NCU043... 31 7.7 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 46.0 bits (104), Expect = 3e-04 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = +3 Query: 126 IYGTGGLLTPLVAPVLXXXXXXXXXXXXXXXXXXYYGNLVAGSL 257 IYGTGGLLTP+VAP+L YYGN+VAGS+ Sbjct: 17 IYGTGGLLTPIVAPMLGFGSAGIAAGSTAAAAQAYYGNVVAGSV 60 >UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Granulibacter bethesdensis CGDNIH1|Rep: Hypothetical cytosolic protein - Granulobacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) Length = 90 Score = 33.9 bits (74), Expect = 1.4 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +2 Query: 62 QKLKEHGA--SSCISGKRGRRCCNIWHWGSVDSISGSRAR 175 Q L+EHG S ++G+R RC N WH G D + R R Sbjct: 42 QALREHGTFQGSMLAGRRILRC-NPWHQGGYDPVPAGRCR 80 >UniRef50_Q01E31 Cluster: Dual specificity phosphatase Cdc25; n=3; Ostreococcus|Rep: Dual specificity phosphatase Cdc25 - Ostreococcus tauri Length = 517 Score = 32.7 bits (71), Expect = 3.3 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = -2 Query: 357 TEKVRSWSDVENG*CLASPHGVGATMAAAVNCDTSCRPL 241 T R+ SD NG C+ G A MAAA CRPL Sbjct: 216 TPFARALSDASNGRCVDGGQGGAAAMAAAAASAMPCRPL 254 >UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12; Bacilli|Rep: Pyrrolidone-carboxylate peptidase - Bacillus subtilis Length = 215 Score = 32.3 bits (70), Expect = 4.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 41 LRIARREQKLKEHGASSCISGKRGRRCCNIWHWGSVDSIS 160 L + R K+KEHG + +S G CN +G +D IS Sbjct: 117 LPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHIS 156 >UniRef50_Q4TGD5 Cluster: Chromosome undetermined SCAF3766, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF3766, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 328 Score = 31.9 bits (69), Expect = 5.8 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -2 Query: 171 AREPLMESTDPQCHILQHRRPRLPLMQLE 85 A +PL T+P+ +LQ+RRP+L L L+ Sbjct: 5 AEQPLSLRTEPKLRVLQYRRPKLELQLLK 33 >UniRef50_Q0KIR5 Cluster: Putative uncharacterized protein; n=1; Solanum demissum|Rep: Putative uncharacterized protein - Solanum demissum (Wild potato) Length = 189 Score = 31.9 bits (69), Expect = 5.8 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -2 Query: 333 DVENG*CLASPHGVGATMAAAVNCDTSCRPLNFRSMLVQQRLC 205 D + G C PH + + A++N T R ++F S++ RLC Sbjct: 82 DADTGCCGVCPHIYLSILEASINSQTVSRSVSFESLIHLSRLC 124 >UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1; n=2; Caenorhabditis|Rep: Laminin related. see also lmb-protein 1 - Caenorhabditis elegans Length = 1067 Score = 31.9 bits (69), Expect = 5.8 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +2 Query: 89 SCISGKRGRRC--CNIWHWGSVDSISGSRARFQLSGN 193 +C SG +G RC C HWGS + G+ R +GN Sbjct: 973 NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009 >UniRef50_Q69YN4 Cluster: Protein KIAA1429; n=52; Euteleostomi|Rep: Protein KIAA1429 - Homo sapiens (Human) Length = 1810 Score = 31.9 bits (69), Expect = 5.8 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = -2 Query: 387 KFKCILIPNKTEKVRSWSDVENG*CLASPHGVGATMAAAVNCDTSCRP 244 +F+ IPN E V+ +++N L +P GVG T A V C+ +C P Sbjct: 900 RFEINCIPNLIEYVKQ--NIDN---LMTPEGVGLTTALRVLCNVACPP 942 >UniRef50_Q8GW81 Cluster: Putative uncharacterized protein At4g16141; n=2; Arabidopsis thaliana|Rep: Putative uncharacterized protein At4g16141 - Arabidopsis thaliana (Mouse-ear cress) Length = 197 Score = 31.5 bits (68), Expect = 7.7 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -2 Query: 360 KTEKVRSWSDVENG*CLASPHGVGATMAAAVNCDTSCRPL 241 K E SDV+NG C +S G G T V+C TS PL Sbjct: 11 KLESAGDSSDVDNGNCSSSGSG-GDTKKTCVDCGTSRTPL 49 >UniRef50_Q7S728 Cluster: Putative uncharacterized protein NCU04333.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU04333.1 - Neurospora crassa Length = 1104 Score = 31.5 bits (68), Expect = 7.7 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = -2 Query: 357 TEKVRSWSDVENG*CLASPHGVGATMAAAVNCDTSCRPLNFRSMLVQQRL 208 T + WS V NG LA+P G G+ AAA + S + +L QR+ Sbjct: 1055 TASGKKWSSVVNGAGLAAPSGSGSLKAAAKQHNDSFKDNKVAYLLFYQRI 1104 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 405,066,766 Number of Sequences: 1657284 Number of extensions: 7322948 Number of successful extensions: 16600 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 16048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16546 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 20653970351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -