BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00146X (585 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 33 0.002 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 25 0.36 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 25 0.36 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 2.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.3 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 5.8 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 7.7 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 7.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 7.7 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 7.7 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 32.7 bits (71), Expect = 0.002 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 303 PSRQPPTAESGLGGSVAATGVPALVXARGHIIEKIP 410 P P+ SGLGG ++ +PAL GH +E +P Sbjct: 76 PYAPHPSLSSGLGGGLSGMPMPALGFGLGHPLESVP 111 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 25.4 bits (53), Expect = 0.36 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 254 FVVDVCSPPRSPGGVGTVASTSDSGERPWRQRCCYRSPSARSX*RTH 394 F VC S T + SGERP+R R C ++ S S H Sbjct: 50 FRCPVCDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKH 96 Score = 21.8 bits (44), Expect = 4.4 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +2 Query: 269 CSPPRSPGGVGTVASTSDSGERPWRQRCCYRSPSARSX*RTH 394 C+ S T + SGE+P+R C R S S TH Sbjct: 27 CNKSFSQAANLTAHVRTHSGEKPFRCPVCDRRFSQSSSVTTH 68 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 25.4 bits (53), Expect = 0.36 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 254 FVVDVCSPPRSPGGVGTVASTSDSGERPWRQRCCYRSPSARSX*RTH 394 F VC S T + SGERP+R R C ++ S S H Sbjct: 306 FRCPVCDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKH 352 Score = 21.8 bits (44), Expect = 4.4 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +2 Query: 269 CSPPRSPGGVGTVASTSDSGERPWRQRCCYRSPSARSX*RTH 394 C+ S T + SGE+P+R C R S S TH Sbjct: 283 CNKSFSQAANLTAHVRTHSGEKPFRCPVCDRRFSQSSSVTTH 324 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +2 Query: 323 SGERPWRQRCCYRSPSARSX*RTH 394 +GERP++ + C R+ + + +TH Sbjct: 158 TGERPFKCKICGRAFTTKGNLKTH 181 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 Query: 125 CVSKEAGHQTSAESW 169 C K+ GH+ S SW Sbjct: 1152 CEEKKPGHKPSTSSW 1166 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/34 (29%), Positives = 13/34 (38%), Gaps = 3/34 (8%) Frame = -2 Query: 239 HPDRTYEYH---HHGHAEFGRQHVQYPMIQHWFG 147 HP T+ YH H+ F H + FG Sbjct: 158 HPGMTFRYHFNVHNSGTHFWHSHSGFQRSDGTFG 191 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -2 Query: 467 PVWSC*SPGLC 435 PVW +PG+C Sbjct: 619 PVWCAQNPGMC 629 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 354 QQRCRQGRSPLSEVDATVPTP 292 QQ+ QG+ P A +P+P Sbjct: 211 QQQPNQGQQPPGNTAAALPSP 231 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = -2 Query: 266 RPPRTCYRRHPDRTYEYHHHGH 201 +PP +R D YEY H Sbjct: 267 KPPHEVEKRAQDGQYEYRSLSH 288 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 354 QQRCRQGRSPLSEVDATVPTP 292 QQ+ QG+ P A +P+P Sbjct: 213 QQQPNQGQQPPGNTAAALPSP 233 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,520 Number of Sequences: 336 Number of extensions: 2947 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -