BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00142 (842 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1224 - 35508842-35510404 30 2.7 01_07_0205 - 41978437-41980599,41980805-41981215 29 4.6 >01_06_1224 - 35508842-35510404 Length = 520 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 228 DTPQEPQQTPEFKIATQLPKDAEFSLFLPKHQEMANELLG 347 +T P P + ++LP D EF L P A+ELLG Sbjct: 53 ETHLPPYAPPPAPVVSELPDDLEFGLHPPPPLVRASELLG 92 >01_07_0205 - 41978437-41980599,41980805-41981215 Length = 857 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -3 Query: 168 LSQKLFCELKHRIV-FALGCDERLIWTIE 85 L +L+CEL +V +A C+ER +W IE Sbjct: 311 LRSRLYCELDDWLVSWADACEERSVWRIE 339 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,101,583 Number of Sequences: 37544 Number of extensions: 426239 Number of successful extensions: 1046 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2338704516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -