BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00142 (842 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21078| Best HMM Match : P120R (HMM E-Value=0.44) 31 1.5 SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25) 29 6.2 >SB_21078| Best HMM Match : P120R (HMM E-Value=0.44) Length = 585 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 568 YSTRRSTHTYYHSTRLHCDGLRRRTPPCVLARRYR-HQPASLSLAFGLPVYGQR 726 YS++R H R H G ++ C++ R + H+PAS+ G +G+R Sbjct: 4 YSSKRMVHRTVTFFRDHLQGAAKKELTCIVFNRDKIHRPASVFDRVGFESFGRR 57 >SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25) Length = 440 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +3 Query: 339 LLGVLMDVPENELQDLLSTCAFARVNLNPQLFNYCYSVALMHRRDTRKV 485 LL +L +PEN+ + V NP+L Y +V L ++ RK+ Sbjct: 384 LLAMLRTLPENQKSKCADMGRSSEVESNPKLPKYKATVRLQEQQSRRKI 432 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,049,801 Number of Sequences: 59808 Number of extensions: 501900 Number of successful extensions: 1337 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1336 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2383424791 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -