BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00140 (568 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 1.7 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 9.2 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.0 bits (52), Expect = 1.7 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 267 FKAGKLNTYRFCDNVWTFMLNDVEFREVQELAKV 368 F+A +LN Y D W+F L DV+F K+ Sbjct: 1329 FEAYELNRYGV-DKEWSFNLADVQFERDNHYLKL 1361 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 22.6 bits (46), Expect = 9.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 112 YRNTTIGNTLQESLDELIQYGQITPALAVKVLLQF 216 YR+ + TL E LD+L + A +VLL F Sbjct: 1547 YRHGEVRKTLAEGLDDLRSDPFLVEADTGQVLLNF 1581 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 493,078 Number of Sequences: 2352 Number of extensions: 8624 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -