BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00133 (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce... 27 2.5 SPACUNK4.15 |||2',3'-cyclic-nucleotide 3'-phosphodiesterase |Sch... 25 7.7 >SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1347 Score = 27.1 bits (57), Expect = 2.5 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +3 Query: 90 SRRGQRDPLKGPGTDRALTRLLVYSRHLERTLNWDNVSRLLQTGDSQRA 236 S G + L GPG D+ +T + + ++T W N L ++ RA Sbjct: 1051 SSGGDKTQLNGPGADQPVTATITF----DKTSPWRNRENLSHNNNTTRA 1095 >SPACUNK4.15 |||2',3'-cyclic-nucleotide 3'-phosphodiesterase |Schizosaccharomyces pombe|chr 1|||Manual Length = 208 Score = 25.4 bits (53), Expect = 7.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 332 DPVEAARGVGGACWKRAC 279 DP+E +G A W +AC Sbjct: 167 DPIETISSIGQASWGKAC 184 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,597,517 Number of Sequences: 5004 Number of extensions: 47913 Number of successful extensions: 123 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -