BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00131X (431 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 24 0.54 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 5.0 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 6.6 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 24.2 bits (50), Expect = 0.54 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +2 Query: 59 TLVNKRSTAASCTRQLKVFLNLKTINVFLPLVV 157 T V K+ A + LKV KT FLP VV Sbjct: 84 TTVRKQQQWAQLIQNLKVVATTKTKAWFLPFVV 116 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 5.0 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -3 Query: 177 LTFHCLRTTNGRKTLMVFKFRNTLSCRVHEAAVERLFTR 61 +TF CL++ R L V K R +++ ++R+ +R Sbjct: 527 VTFQCLKSIAWRAFLAVLKRRT----EIYKGLIDRIKSR 561 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 20.6 bits (41), Expect = 6.6 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 94 YSTTQSIPKLED 129 Y T Q++P+LED Sbjct: 157 YETFQNLPELED 168 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,481 Number of Sequences: 336 Number of extensions: 1476 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9565283 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -