BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00131X (431 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64050.1 68414.m07255 expressed protein 27 7.2 At5g48390.1 68418.m05983 tetratricopeptide repeat (TPR)-containi... 26 9.6 At2g34830.1 68415.m04276 WRKY family transcription factor 26 9.6 >At1g64050.1 68414.m07255 expressed protein Length = 668 Score = 26.6 bits (56), Expect = 7.2 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 159 RTTNGRKTLMVFKFRNTLSCRVHEAAVERL 70 +T G KT KF NT+SC+ EA+V L Sbjct: 458 QTITGVKTSQT-KFANTISCQCAEASVSTL 486 >At5g48390.1 68418.m05983 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 900 Score = 26.2 bits (55), Expect = 9.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 297 QSVRNSCTLSHSAISALRTPASVCSSSCIL 208 Q +SC ++H AIS P +V S S L Sbjct: 518 QKKEHSCAIAHEAISCQALPVAVASLSKFL 547 >At2g34830.1 68415.m04276 WRKY family transcription factor Length = 427 Score = 26.2 bits (55), Expect = 9.6 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -3 Query: 237 ASVCSSSCILVLRAEXSKSVLTFHCLRTTNG-RKTLMVFKFRNTLSC 100 AS C+S I V A + S + TTN R L+V NT SC Sbjct: 125 ASTCNSPAITVSSAAVAASPWGMINVNTTNSPRNCLLVDNNNNTSSC 171 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,466,801 Number of Sequences: 28952 Number of extensions: 133982 Number of successful extensions: 300 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 300 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 685039728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -