BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00128 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 3.8 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 5.0 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 8.7 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 8.7 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 8.7 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 660 AARPNL*GFYVSLSDNSQ*IQCL 592 A+ PN FY S N+Q ++CL Sbjct: 792 ASMPNFADFYSEESINNQGLECL 814 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.2 bits (45), Expect = 5.0 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +2 Query: 479 VYNILEGKSEQIELYMTIKVKRKDLCSSPI*SGTVLPKRHCIYWLL 616 V L GK + I + ++ KD+ P+ + + L KRH I ++ Sbjct: 106 VVKYLGGKHKFISKKIKKTMENKDITKRPLPNESQLIKRHPIVTIM 151 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 574 WDGLTQETLYLLAIVRQRDIKALEIWTSSI 663 W G+ E + +V++ KALE+ ++ Sbjct: 678 WKGMLSEKILAEPLVKEHFKKALELMNRAV 707 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 615 CQTKRHKSLRD 647 CQ K H SLRD Sbjct: 16 CQAKAHYSLRD 26 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 144 TACVVGKFKDKSG 182 T C +GKFK ++G Sbjct: 263 TECPIGKFKHEAG 275 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,145 Number of Sequences: 438 Number of extensions: 4249 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -