BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00128 (710 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32320.1 68417.m04597 peroxidase family protein similar to L-... 28 7.0 At1g62030.1 68414.m06996 DC1 domain-containing protein contains ... 28 7.0 >At4g32320.1 68417.m04597 peroxidase family protein similar to L-ascorbate peroxidase [Arabidopsis thaliana] gi|1523789|emb|CAA66925; contains Pfam profile PF00141: Peroxidase Length = 329 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +2 Query: 263 LKTF-FENDIYGNFECFPPSTINGVKTTIIYPATDKHIAKFSQ 388 +KTF F D + +F+ F + KT ++ PAT+KH+ + S+ Sbjct: 9 VKTFLFRCDSFSSFK-FKCKFESPAKTRLLSPATEKHVVRSSR 50 >At1g62030.1 68414.m06996 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 743 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -3 Query: 603 IQCLLGKTVPLQIGEEHKSFLFTFIVMYNSICSLLPSRMLYTHCKLNC 460 I+CLLG+ + ++ G SF F +Y +R + +HCK C Sbjct: 646 IECLLGQDLYVKPGSSWISFSFNGEKIYVRANDHHMTRPICSHCKKRC 693 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,883,383 Number of Sequences: 28952 Number of extensions: 306924 Number of successful extensions: 750 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -