BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00127 (434 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0666 + 26561185-26561285,26561391-26561743,26562360-265623... 27 6.6 02_04_0373 - 22453074-22453358,22453590-22453715 27 6.6 >03_05_0666 + 26561185-26561285,26561391-26561743,26562360-26562361, 26562687-26563146,26572609-26572973 Length = 426 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 385 WPHQGFRFVRPP*FVYL*VAAMPLADLLTYQSRNFY*RVDVVSRCR 248 WP QGF+ R P + + V +P +T Q+R+ + ++ S+ R Sbjct: 369 WPSQGFKNRRGPGYRHPAVRRLPAVTAVTAQNRDKFTNRNLNSKIR 414 >02_04_0373 - 22453074-22453358,22453590-22453715 Length = 136 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 161 GRSGRGVFGKLFSKKQHKERDERATE 238 GR RGV G KQ +E DER E Sbjct: 83 GRGERGVDGLWSGGKQRREHDERGVE 108 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,236,456 Number of Sequences: 37544 Number of extensions: 245764 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 826450812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -