BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00126 (808 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 24 1.2 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 8.7 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 21 8.7 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -2 Query: 243 KFIVSKLGMSALGELDSALSTSLSTVREHLARNRRASNLCHLPSLYARVV 94 K + + LGM E + S+ V E L + +N+ L +YA VV Sbjct: 231 KQLAAALGMQTTNEKEIFERLSILPVDEFLQISEEVANIWGLKKVYAPVV 280 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 8.7 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = -2 Query: 243 KFIVSKLGMSALGELDSALSTSLSTVREHLARNRRASNLCHLPSLYARVV 94 K + + LGM E + S V + L + + +N+ L +YA VV Sbjct: 229 KQLAAALGMQTTNEKEIFERLSALPVDKLLQISEKVANIWGLKKVYAPVV 278 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 8.7 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = -2 Query: 243 KFIVSKLGMSALGELDSALSTSLSTVREHLARNRRASNLCHLPSLYARVV 94 K + + LGM E + S+ V + L + +N+ L +YA VV Sbjct: 229 KQLAAALGMQTTNEKEIFERLSVLPVDKLLQISEEVANIWGLKKVYAPVV 278 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,421 Number of Sequences: 336 Number of extensions: 4059 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -