BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00126 (808 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 28 0.39 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 26 1.6 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 24 4.8 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 6.3 Z49813-1|CAA89967.1| 247|Anopheles gambiae serine proteinase pr... 23 8.4 AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein prot... 23 8.4 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 8.4 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 27.9 bits (59), Expect = 0.39 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 192 ALSTSLSTVREHLARNRRASNLCH-LPSLYARVVPTIIKSSVLP 64 +++TS ST++ H A + H LP++Y P I+K+ P Sbjct: 27 SIATSHSTIQHHAAPAIQHVGSVHALPAIYQHSAPAIVKTIAQP 70 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.8 bits (54), Expect = 1.6 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -2 Query: 192 ALSTSLSTVREHLARNRRASNLCHL-PSLYARVVPTIIKSSVLP 64 +++TS S+++ H A H P++Y PTI+K+ P Sbjct: 27 SIATSHSSIQHHAAPAIHHVGSIHAAPAIYQHSAPTIVKTIAQP 70 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 24.2 bits (50), Expect = 4.8 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = -1 Query: 391 PTKRTGIHTPCRSILDSH*DPVLLR*C*SASYNRRSLDPALAVFLCVPSEVHSV*ARYVG 212 P+K+ + RSIL H P+ + Y R + L ++ P+ V +V V Sbjct: 344 PSKQAILRKELRSILPHHDSPLTPENMRNLPYLRACIKEGLRLYQPTPANVRNVGHNIVL 403 Query: 211 AG-RIGLRFEHLVVHGQRALGKEPA 140 G RI E VV G AL ++ A Sbjct: 404 QGYRIPKGTE--VVMGTLALQRDAA 426 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 6.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 197 SNSPSADIPSLDTMNFGGNT 256 SN+P D+ S D + FG T Sbjct: 112 SNTPVTDVASADVLFFGSET 131 >Z49813-1|CAA89967.1| 247|Anopheles gambiae serine proteinase protein. Length = 247 Score = 23.4 bits (48), Expect = 8.4 Identities = 12/46 (26%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = +3 Query: 633 HVLTVTHNTSALK-----LVVDDFDYFSTDTAPPPLHILDGVLFHR 755 +VLT H LK +++ D+D F P + + ++ HR Sbjct: 44 YVLTAAHCVRRLKRNKIRVILGDYDQFVASETPAIMRAVTAIIRHR 89 >AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein protein. Length = 163 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/57 (22%), Positives = 26/57 (45%) Frame = +3 Query: 537 SISLSLVNGKLVVVSQREQLDTGLNTYNDSQWHVLTVTHNTSALKLVVDDFDYFSTD 707 ++++ V G +V ++ T T + ++W+ TV V+D DY T+ Sbjct: 105 NLTIKYVRGLDPIVKLMDEQGTVKETLSINKWNTDTVQEFFETRLAKVEDDDYIKTN 161 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.4 bits (48), Expect = 8.4 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 34 RWKGLLAGVIRQHR 75 RW G++ G+ R+H+ Sbjct: 402 RWHGMIDGIFRRHK 415 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 857,551 Number of Sequences: 2352 Number of extensions: 17913 Number of successful extensions: 31 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85239615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -