BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00126 (808 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74630.1 68414.m08643 pentatricopeptide (PPR) repeat-containi... 33 0.29 At1g23800.1 68414.m03002 aldehyde dehydrogenase, mitochondrial (... 31 1.2 At3g29200.1 68416.m03662 chorismate mutase, chloroplast (CM1) id... 29 2.7 At4g21160.4 68417.m03061 zinc finger and C2 domain protein (ZAC)... 29 4.8 At4g21160.3 68417.m03060 zinc finger and C2 domain protein (ZAC)... 29 4.8 At4g21160.2 68417.m03059 zinc finger and C2 domain protein (ZAC)... 29 4.8 At4g21160.1 68417.m03058 zinc finger and C2 domain protein (ZAC)... 29 4.8 At3g58050.1 68416.m06471 expressed protein 29 4.8 At1g66370.1 68414.m07538 myb family transcription factor (MYB113... 29 4.8 At4g33010.1 68417.m04695 glycine dehydrogenase [decarboxylating]... 28 6.3 At2g26080.1 68415.m03131 glycine dehydrogenase [decarboxylating]... 28 6.3 At1g15550.1 68414.m01870 gibberellin 3-beta-dioxygenase / gibber... 28 6.3 At5g12860.1 68418.m01476 oxoglutarate/malate translocator, putat... 28 8.4 At4g26930.1 68417.m03875 myb family transcription factor (MYB97)... 28 8.4 At1g56650.1 68414.m06515 myb family transcription factor (MYB75)... 28 8.4 >At1g74630.1 68414.m08643 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 643 Score = 32.7 bits (71), Expect = 0.29 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = -2 Query: 417 VAVSTVERYQRSELASIRHADRF*ILTEIQFYSVDADLPHTTVEASIRHLQYSFVFPPKF 238 +++S Y R L D F T ++ YS ++D PH +V + ++ FVFP F Sbjct: 49 ISISDALPYARRLLLCFPEPDAFMFNTLVRGYS-ESDEPHNSVAVFVEMMRKGFVFPDSF 107 >At1g23800.1 68414.m03002 aldehyde dehydrogenase, mitochondrial (ALDH3) nearly identical to mitochondrial aldehyde dehydrogenase ALDH3 [Arabidopsis thaliana] gi|19850249|gb|AAL99612; contains Pfam profile PF00171: aldehyde dehydrogenase (NAD) family protein Length = 534 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +2 Query: 5 GGYFFSLLMQDGRVYLQVSLGNTEDL--IIVGTTRAYNDGKWHKLDA 139 G F +L ++G V QVS G+ ED+ + +A+++G W K+ A Sbjct: 68 GKTFPTLDPRNGEVIAQVSEGDAEDVNRAVAAARKAFDEGPWPKMTA 114 >At3g29200.1 68416.m03662 chorismate mutase, chloroplast (CM1) identical to chorismate mutase GB:Z26519 [SP|P42738] [Arabidopsis thaliana] Length = 340 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 359 PIDSRFSLRSSFTPLMLIC-LIQPSKPRSGTCSI 261 PI + L S+ + + C L QPSKPRSGT S+ Sbjct: 31 PISTLLPLPSTKSSFSVRCSLPQPSKPRSGTSSV 64 >At4g21160.4 68417.m03061 zinc finger and C2 domain protein (ZAC) identical to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 337 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = +3 Query: 567 LVVVSQREQLDTGLNTYNDSQWH---VLTVTHNTSALKLVVDDFDYFSTD 707 ++ + Q++ T + + + W+ +L+V HN ++KL V D+D FS D Sbjct: 206 VLTLGQQKAQSTVVKSNLNPVWNEELMLSVPHNYGSVKLQVFDYDTFSAD 255 >At4g21160.3 68417.m03060 zinc finger and C2 domain protein (ZAC) identical to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 337 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = +3 Query: 567 LVVVSQREQLDTGLNTYNDSQWH---VLTVTHNTSALKLVVDDFDYFSTD 707 ++ + Q++ T + + + W+ +L+V HN ++KL V D+D FS D Sbjct: 206 VLTLGQQKAQSTVVKSNLNPVWNEELMLSVPHNYGSVKLQVFDYDTFSAD 255 >At4g21160.2 68417.m03059 zinc finger and C2 domain protein (ZAC) identical to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 337 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = +3 Query: 567 LVVVSQREQLDTGLNTYNDSQWH---VLTVTHNTSALKLVVDDFDYFSTD 707 ++ + Q++ T + + + W+ +L+V HN ++KL V D+D FS D Sbjct: 206 VLTLGQQKAQSTVVKSNLNPVWNEELMLSVPHNYGSVKLQVFDYDTFSAD 255 >At4g21160.1 68417.m03058 zinc finger and C2 domain protein (ZAC) identical to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 337 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = +3 Query: 567 LVVVSQREQLDTGLNTYNDSQWH---VLTVTHNTSALKLVVDDFDYFSTD 707 ++ + Q++ T + + + W+ +L+V HN ++KL V D+D FS D Sbjct: 206 VLTLGQQKAQSTVVKSNLNPVWNEELMLSVPHNYGSVKLQVFDYDTFSAD 255 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 265 LQVPDRGFDGCMRQISINGVK 327 L+VP RGF+G RQ+ +N K Sbjct: 714 LEVPSRGFNGSNRQLRVNASK 734 >At1g66370.1 68414.m07538 myb family transcription factor (MYB113) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 246 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 74 EDLIIVGTTRAYNDGKWHKLDARRFLAKC 160 ED+++ Y +GKWH++ R L +C Sbjct: 17 EDILLRQCIDKYGEGKWHRVPLRTGLNRC 45 >At4g33010.1 68417.m04695 glycine dehydrogenase [decarboxylating], putative / glycine decarboxylase, putative / glycine cleavage system P-protein, putative strong similarity to SP|P49361 Glycine dehydrogenase [decarboxylating] A, mitochondrial precursor (EC 1.4.4.2) {Flaveria pringlei}; contains Pfam profile PF02347: Glycine cleavage system P-protein Length = 1037 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/69 (26%), Positives = 33/69 (47%) Frame = -2 Query: 303 PHTTVEASIRHLQYSFVFPPKFIVSKLGMSALGELDSALSTSLSTVREHLARNRRASNLC 124 PH A+ + +Y + P + I G+S AL ++ T +H+ R++ SN+C Sbjct: 349 PHAAFLATSQ--EYKRMMPGRII----GISVDSSGKQALRMAMQTREQHIRRDKATSNIC 402 Query: 123 HLPSLYARV 97 +L A + Sbjct: 403 TAQALLANM 411 >At2g26080.1 68415.m03131 glycine dehydrogenase [decarboxylating], putative / glycine decarboxylase, putative / glycine cleavage system P-protein, putative strong similarity to SP|P26969 Glycine dehydrogenase [decarboxylating], mitochondrial precursor (EC 1.4.4.2) {Pisum sativum}; contains Pfam profile PF02347: Glycine cleavage system P-protein Length = 1044 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/69 (26%), Positives = 33/69 (47%) Frame = -2 Query: 303 PHTTVEASIRHLQYSFVFPPKFIVSKLGMSALGELDSALSTSLSTVREHLARNRRASNLC 124 PH A+ + +Y + P + I G+S AL ++ T +H+ R++ SN+C Sbjct: 355 PHAAFLATSQ--EYKRMMPGRII----GVSVDSSGKQALRMAMQTREQHIRRDKATSNIC 408 Query: 123 HLPSLYARV 97 +L A + Sbjct: 409 TAQALLANM 417 >At1g15550.1 68414.m01870 gibberellin 3-beta-dioxygenase / gibberellin 3 beta-hydroxylase (GA4) identical to gibberellin 3 beta-hydroxylase [GI:2160454] Length = 358 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 603 GLNTYNDSQWHVLTVTHNTSALKLVVDDFDYFSTDTAPPPLHILDGVLFH 752 GL + DS + +NT+ L++ DD + + P L + G LFH Sbjct: 228 GLAAHTDSTLLTILYQNNTAGLQVFRDDLGWVTVPPFPGSLVVNVGDLFH 277 >At5g12860.1 68418.m01476 oxoglutarate/malate translocator, putative similar to 2-oxoglutarate/malate translocator precursor, spinach, SWISSPROT:Q41364 Length = 557 Score = 27.9 bits (59), Expect = 8.4 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = -3 Query: 467 NLRVSCGFSLVTSTKRR*LSVPLNDTNEANWHPYAMPIDSRFSLRSSFTPLML 309 +L +S SL K R LS+P ++ N +DSRFSL S P+ L Sbjct: 3 SLALSGSCSLAFPLKSRSLSLPRPPSSSLNLTKPLRSLDSRFSLLKSPLPVSL 55 >At4g26930.1 68417.m03875 myb family transcription factor (MYB97) contains Pfam profile: PF00249 myb-like DNA-binding domain ;similar to anther-specific myb-related protein 2 GI:11066263 from [Nicotiana tabacum] Length = 389 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +2 Query: 74 EDLIIVGTTRAYNDGKWHKLDARRFLAKC 160 ED + R Y +G W+ + + +LA+C Sbjct: 28 EDETLAAYVREYGEGNWNSVQKKTWLARC 56 >At1g56650.1 68414.m06515 myb family transcription factor (MYB75) contains Pfam profile: PF00249 myb-like DNA-binding domain; identical to cDNA putative transcription factor (MYB75) GI:3941507 Length = 248 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 74 EDLIIVGTTRAYNDGKWHKLDARRFLAKC 160 ED ++ Y +GKWH++ R L +C Sbjct: 17 EDSLLRQCINKYGEGKWHQVPVRAGLNRC 45 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,714,977 Number of Sequences: 28952 Number of extensions: 367838 Number of successful extensions: 999 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 999 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -