BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00124X (524 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) simi... 103 6e-23 At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ... 102 1e-22 At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) 98 3e-21 At2g02640.1 68415.m00203 DC1 domain-containing protein contain... 31 0.47 At1g05440.1 68414.m00552 expressed protein ; expression supporte... 30 1.1 At3g28360.1 68416.m03544 ABC transporter family protein similar ... 29 1.4 At1g16850.1 68414.m02033 expressed protein 29 1.4 At4g03470.1 68417.m00474 ankyrin repeat family protein contains ... 29 2.5 At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-b... 28 3.3 At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-g... 28 3.3 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 28 3.3 At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to hom... 28 3.3 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 28 4.4 At4g35730.1 68417.m05071 expressed protein contains Pfam profil... 27 5.8 At1g32190.1 68414.m03959 expressed protein 27 5.8 At3g28380.1 68416.m03546 P-glycoprotein, putative similar to P-g... 27 7.7 At3g28345.1 68416.m03541 ABC transporter family protein similar ... 27 7.7 >At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) similar to GB:P42791 Length = 187 Score = 103 bits (248), Expect = 6e-23 Identities = 51/87 (58%), Positives = 65/87 (74%) Frame = +2 Query: 263 IAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRAPTGKKTVL 442 IAV+VGT+T+D+R+++IP M V AL TE+ARARI AGGE LTFDQLALRAP G+ TVL Sbjct: 78 IAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVL 137 Query: 443 VQGQRNAREADASLWPCSRSSASHTKP 523 ++G +N+REA P SH+KP Sbjct: 138 LRGPKNSREAVKHFGPAPGVPHSHSKP 164 Score = 57.2 bits (132), Expect = 6e-09 Identities = 29/71 (40%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +3 Query: 30 MGID-INHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRP 206 MGID I +K +RT KS D+ TN+KFN ++L+RLFMS++N+ Sbjct: 1 MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKA 60 Query: 207 PISVSRLARHM 239 P+S+SRL M Sbjct: 61 PLSLSRLVEFM 71 >At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ribosomal protein L18, Arabidopsis thaliana, SWISSPROT:RL18_ARATH Length = 187 Score = 102 bits (245), Expect = 1e-22 Identities = 51/87 (58%), Positives = 65/87 (74%) Frame = +2 Query: 263 IAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRAPTGKKTVL 442 IAV+VGT+T+D+R+++IP M V AL TE+ARARI AGGE LTFDQLALRAP G+ TVL Sbjct: 78 IAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVL 137 Query: 443 VQGQRNAREADASLWPCSRSSASHTKP 523 ++G +N+REA P S+TKP Sbjct: 138 LRGPKNSREAVKHFGPAPGVPHSNTKP 164 Score = 54.0 bits (124), Expect = 6e-08 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = +3 Query: 30 MGID-INHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRP 206 MGID I +K +RT KS D+ +N+ FN ++L+RLFMS++N+ Sbjct: 1 MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKA 60 Query: 207 PISVSRLARHM 239 P+S+SRL M Sbjct: 61 PLSLSRLVEFM 71 >At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) Length = 135 Score = 98.3 bits (234), Expect = 3e-21 Identities = 52/90 (57%), Positives = 61/90 (67%), Gaps = 1/90 (1%) Frame = +2 Query: 257 GLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRAPT-GKK 433 G IAV+VGTVT+DVR+ +P +TV AL TE ARARI AGGE LTFDQLAL PT + Sbjct: 23 GKIAVIVGTVTDDVRIEDVPALTVTALRFTESARARIHKAGGECLTFDQLALPCPTWSEN 82 Query: 434 TVLVQGQRNAREADASLWPCSRSSASHTKP 523 TVL++G +N REA P SHTKP Sbjct: 83 TVLLRGPKNTREAVKHFGPAPGVPHSHTKP 112 Score = 28.3 bits (60), Expect = 3.3 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 186 MSRINRPPISVSRLARHM 239 MS++N+ P+S+SRL R+M Sbjct: 1 MSKVNKAPLSLSRLVRYM 18 >At2g02640.1 68415.m00203 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 627 Score = 31.1 bits (67), Expect = 0.47 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 331 CSSCYRKSSCTHFGCWRRNSYF 396 CS+C RKS+ + C+ RN YF Sbjct: 423 CSACMRKSNGFGYSCYNRNCYF 444 >At1g05440.1 68414.m00552 expressed protein ; expression supported by MPSS Length = 393 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -2 Query: 475 ICLTSISLTLYQYCLLASRSTKSQLIKSKNFSSSSQNACTSF 350 ICL S++ TL L +S+ ++L + NF S+ ++ TSF Sbjct: 70 ICLDSLNATLDLMPLSVQKSSLTKLSSASNFKSTVESTPTSF 111 >At3g28360.1 68416.m03544 ABC transporter family protein similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1158 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 383 EILTFDQLALRAPTGKKTVLVQGQRNAREADASL 484 E L FD L L+ P+GK LV G + + SL Sbjct: 290 ETLIFDDLCLKIPSGKTVALVGGSGSGKSTVISL 323 >At1g16850.1 68414.m02033 expressed protein Length = 152 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 405 WLFVLRLARRQYWYKVSEMLVRQMRHFGP 491 WL ++ + + YW KV E L R HF P Sbjct: 50 WLTKIKRSGKNYWAKVRETLDRGQSHFFP 78 >At4g03470.1 68417.m00474 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 683 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/63 (26%), Positives = 30/63 (47%) Frame = -2 Query: 325 RHLRYLVQSHVICDCPHYHGNQTLRVGFFMWRAKRDTEIGGRLIRLIKSRRRTI*LNLAF 146 RHL Q + + + GN L + WR + E+GG+ LI++ + L++A Sbjct: 389 RHLTAHEQINHLANEKDVDGNTPLHLATIYWRPRAVRELGGKKNLLIQNNNGLVALDIAE 448 Query: 145 VRL 137 +L Sbjct: 449 SKL 451 >At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-binding cassette; related to multi drug resistance proteins Length = 1221 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 395 FDQLALRAPTGKKTVLVQGQRNAREADASL 484 FD L LR P+GK LV G + + SL Sbjct: 356 FDDLCLRIPSGKSVALVGGSGSGKSTVISL 385 >At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1225 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 395 FDQLALRAPTGKKTVLVQGQRNAREADASL 484 FD L LR P+GK LV G + + SL Sbjct: 365 FDDLCLRVPSGKTVALVGGSGSGKSTVISL 394 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 28.3 bits (60), Expect = 3.3 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 295 RETVQDTEDDGGCSSCY--RKSSCTHFGCWRRNSYF*SAGSSCS 420 R+ + +E GGC+SC KS T C R+ + S G+ CS Sbjct: 145 RDHGECSESVGGCASCIVRSKSDITTSQCGDRDRRYTSPGNPCS 188 >At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to homeodomain transcription factor (AGL30) GI:3461830 from [Arabidopsis thaliana]; contains Pfam domain PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); PMID: 12837945 Length = 389 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 473 LPHEHFADLVPVLSSCQSEHEEPADQ 396 LPH +PV SSC E +P DQ Sbjct: 228 LPHREMDGSIPVYSSCFFESTKPEDQ 253 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 398 DQLALRAPTGKKTVLVQGQRNAREADASLWPCSRSSA 508 D++ PTGK + QG R ++ D P +SSA Sbjct: 388 DKVVTPTPTGKANLSYQGVRASKSGDDKKTPYQKSSA 424 >At4g35730.1 68417.m05071 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 430 Score = 27.5 bits (58), Expect = 5.8 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +1 Query: 322 DGGCSSCYRKSSCTHFGCWRRNSYF*SAGSSCSDWQEDSTGTRS 453 D SS Y K + G RR+SY + G + SD++E+ T T + Sbjct: 289 DSETSSYYAKPGAENRGMGRRHSYN-NPGINESDYEEEYTNTEA 331 >At1g32190.1 68414.m03959 expressed protein Length = 422 Score = 27.5 bits (58), Expect = 5.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 331 CSSCYRKSSCTHFGCWR 381 CSSC+ K C CW+ Sbjct: 359 CSSCFGKPKCPKCSCWK 375 >At3g28380.1 68416.m03546 P-glycoprotein, putative similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1240 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 383 EILTFDQLALRAPTGKKTVLVQGQRNAREADASL 484 E FD L L+ P GK LV G + + SL Sbjct: 373 ETTIFDDLCLKIPAGKTVALVGGSGSGKSTVISL 406 >At3g28345.1 68416.m03541 ABC transporter family protein similar to P-glycoprotein [Arabidopsis thaliana] GI:3849833; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1240 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 383 EILTFDQLALRAPTGKKTVLVQGQRNAREADASL 484 E FD LR P+GK LV G + + SL Sbjct: 373 ETSIFDDFCLRVPSGKTVALVGGSGSGKSTVISL 406 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,140,845 Number of Sequences: 28952 Number of extensions: 260244 Number of successful extensions: 754 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -