BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00123 (832 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060391-1|AAL25430.1| 301|Drosophila melanogaster LD29815p pro... 30 4.5 AE014134-3239|AAF53892.2| 301|Drosophila melanogaster CG10954-P... 30 4.5 >AY060391-1|AAL25430.1| 301|Drosophila melanogaster LD29815p protein. Length = 301 Score = 29.9 bits (64), Expect = 4.5 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -3 Query: 530 RFSTINLHELFLFTLGIYHLKLAKSYCHEHMRPNGVYIMELYHR 399 R +TINL +F L YH+K +K+Y H MR +++ +R Sbjct: 237 RDNTINLIHMFRDYLH-YHIKCSKAYIHSRMRAKTSDFLKVLNR 279 >AE014134-3239|AAF53892.2| 301|Drosophila melanogaster CG10954-PA protein. Length = 301 Score = 29.9 bits (64), Expect = 4.5 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -3 Query: 530 RFSTINLHELFLFTLGIYHLKLAKSYCHEHMRPNGVYIMELYHR 399 R +TINL +F L YH+K +K+Y H MR +++ +R Sbjct: 237 RDNTINLIHMFRDYLH-YHIKCSKAYIHSRMRAKTSDFLKVLNR 279 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,410,142 Number of Sequences: 53049 Number of extensions: 736779 Number of successful extensions: 1881 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1881 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3942192384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -