BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00121X (588 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 23 7.3 AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N p... 23 9.7 AY341149-1|AAR13713.1| 164|Anopheles gambiae aminopeptidase N p... 23 9.7 AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N p... 23 9.7 AY341147-1|AAR13711.1| 164|Anopheles gambiae aminopeptidase N p... 23 9.7 AY341146-1|AAR13710.1| 164|Anopheles gambiae aminopeptidase N p... 23 9.7 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 9.7 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -2 Query: 413 IKTYYILNNKLQYTYYYRHYYEKLWVDHFCADIYNFPHNT 294 + +Y L +L+ + H LW D + DIY F N+ Sbjct: 196 VASYGFLKRRLESHDLHIH---ALWFDIYTGDIYFFSRNS 232 >AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 22.6 bits (46), Expect = 9.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 401 YILNNKLQYTYYYRHYYEKLWV 336 +I+ N Q YY +Y E LW+ Sbjct: 115 FIVVNPQQTGYYRVNYDENLWI 136 >AY341149-1|AAR13713.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 22.6 bits (46), Expect = 9.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 401 YILNNKLQYTYYYRHYYEKLWV 336 +I+ N Q YY +Y E LW+ Sbjct: 115 FIVVNPQQTGYYRVNYDENLWI 136 >AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 22.6 bits (46), Expect = 9.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 401 YILNNKLQYTYYYRHYYEKLWV 336 +I+ N Q YY +Y E LW+ Sbjct: 115 FIVVNPQQTGYYRVNYDENLWI 136 >AY341147-1|AAR13711.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 22.6 bits (46), Expect = 9.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 401 YILNNKLQYTYYYRHYYEKLWV 336 +I+ N Q YY +Y E LW+ Sbjct: 115 FIVVNPQQTGYYRVNYDENLWI 136 >AY341146-1|AAR13710.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 22.6 bits (46), Expect = 9.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 401 YILNNKLQYTYYYRHYYEKLWV 336 +I+ N Q YY +Y E LW+ Sbjct: 115 FIVVNPQQTGYYRVNYDENLWI 136 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 9.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 268 KRINMHYCNVLCG 306 KR MH CN+L G Sbjct: 605 KRFRMHECNLLIG 617 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,307 Number of Sequences: 2352 Number of extensions: 9126 Number of successful extensions: 65 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -