BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00121X (588 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28929-5|AAA68348.2| 438|Caenorhabditis elegans Gaba/glycine re... 27 7.5 U28741-1|AAA68325.2| 256|Caenorhabditis elegans Hypothetical pr... 27 7.5 U40061-4|AAA81151.3| 239|Caenorhabditis elegans Hypothetical pr... 27 9.9 >U28929-5|AAA68348.2| 438|Caenorhabditis elegans Gaba/glycine receptor family (seegbr) protein 3 protein. Length = 438 Score = 27.5 bits (58), Expect = 7.5 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +2 Query: 392 LKYNKF*CKTGVSLVSAIDNR*LWKHYFCAYCFLSTQIQFMKT*KTLLPIW 544 L+Y CKT +SL S + R LW C STQ+ LL I+ Sbjct: 94 LEYRNISCKTNLSLDSYVSER-LWTPNVCFVNSKSTQVHKSPASNILLIIY 143 >U28741-1|AAA68325.2| 256|Caenorhabditis elegans Hypothetical protein F35D2.3 protein. Length = 256 Score = 27.5 bits (58), Expect = 7.5 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +3 Query: 447 ITDDF----GNIIFARIVFCLLKFNS*KLKKPYCLYGGRAHSPTWVVK 578 +TDD+ G+I+ + C L++ + ++ CL GGR HS V+ Sbjct: 27 LTDDYCKNGGSIVNGKCE-CTLRYEGPQCERERCLNGGRRHSAKGTVR 73 >U40061-4|AAA81151.3| 239|Caenorhabditis elegans Hypothetical protein ZK563.5 protein. Length = 239 Score = 27.1 bits (57), Expect = 9.9 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -2 Query: 392 NNKLQYTYYYRHYYEKLWVDHFCADIYNFPHNTL 291 N+ + T +R Y++K W++ + ++NF +L Sbjct: 134 NHHAKDTEPFRKYFDKTWIEIYYVSLHNFLSTSL 167 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,270,772 Number of Sequences: 27780 Number of extensions: 225565 Number of successful extensions: 466 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1237082886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -