BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00112 (686 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9U505 Cluster: ATP synthase lipid-binding protein, mit... 91 3e-17 UniRef50_P48201 Cluster: ATP synthase lipid-binding protein, mit... 64 4e-09 UniRef50_P05496 Cluster: ATP synthase lipid-binding protein, mit... 64 4e-09 UniRef50_P48880 Cluster: ATP synthase protein 9, mitochondrial; ... 55 1e-06 UniRef50_UPI0000E25CD7 Cluster: PREDICTED: hypothetical protein ... 54 2e-06 UniRef50_Q01554 Cluster: ATP synthase protein 9, mitochondrial; ... 50 5e-05 UniRef50_UPI0000D573BE Cluster: PREDICTED: similar to CG13320-PA... 48 2e-04 UniRef50_P60112 Cluster: ATP synthase protein 9, mitochondrial; ... 46 9e-04 UniRef50_Q4Q9E5 Cluster: ATPase subunit 9, putative; n=15; Trypa... 45 0.002 UniRef50_P00842 Cluster: ATP synthase protein 9, mitochondrial p... 44 0.003 UniRef50_UPI0000EBC8A1 Cluster: PREDICTED: hypothetical protein;... 44 0.005 UniRef50_A6RZ18 Cluster: Lipid-binding protein; n=2; Sclerotinia... 42 0.014 UniRef50_A3E3Y1 Cluster: Lipid-binding protein; n=1; Karlodinium... 40 0.075 UniRef50_Q7RI18 Cluster: ATPase subunit 9, putative; n=4; Plasmo... 38 0.30 UniRef50_Q4N435 Cluster: ATP synthase F0, subunit C, putative; n... 37 0.40 UniRef50_Q37315 Cluster: ATP synthase protein 9, mitochondrial; ... 36 1.2 UniRef50_A6R851 Cluster: Predicted protein; n=1; Ajellomyces cap... 35 1.6 UniRef50_Q8NHP8 Cluster: LAMA-like protein 2 precursor; n=24; De... 34 2.8 UniRef50_Q1DF55 Cluster: Dual specificity phosphatase; n=1; Myxo... 34 3.7 UniRef50_Q8SVL2 Cluster: Putative uncharacterized protein ECU05_... 34 3.7 UniRef50_Q7WJB6 Cluster: Flagellar hook-length control protein; ... 33 6.5 UniRef50_A7NYC2 Cluster: Chromosome chr6 scaffold_3, whole genom... 33 6.5 UniRef50_Q7PQV9 Cluster: ENSANGP00000003034; n=1; Anopheles gamb... 33 6.5 UniRef50_Q17AJ3 Cluster: Putative uncharacterized protein; n=1; ... 33 6.5 UniRef50_UPI000065F4A6 Cluster: Homolog of Homo sapiens "Keratin... 33 8.6 UniRef50_Q5FRW6 Cluster: ATP synthase C chain; n=4; Rhodospirill... 33 8.6 UniRef50_Q1NQF8 Cluster: Putative uncharacterized protein; n=1; ... 33 8.6 UniRef50_Q06G99 Cluster: Putative uncharacterized protein; n=1; ... 33 8.6 UniRef50_Q0CN36 Cluster: Predicted protein; n=2; Aspergillus|Rep... 33 8.6 >UniRef50_Q9U505 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=143; Eukaryota|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 131 Score = 90.6 bits (215), Expect = 3e-17 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = +3 Query: 99 FCNSALVRPLAAVPTHTQMVPAVPTQLSAVRSFQTTSVTKDIDSAAKFIGAG 254 F N+A+VRPLAAV T TQ+VPA P QLSAVRSFQTTSVTKDIDSAAKFIGAG Sbjct: 17 FSNAAVVRPLAAVSTQTQLVPAAPAQLSAVRSFQTTSVTKDIDSAAKFIGAG 68 Score = 63.7 bits (148), Expect = 4e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 85 FGSLIIGYARNPSLKQQLFSYAILGFALSE 114 >UniRef50_P48201 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=111; cellular organisms|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Homo sapiens (Human) Length = 142 Score = 63.7 bits (148), Expect = 4e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 96 FGSLIIGYARNPSLKQQLFSYAILGFALSE 125 Score = 38.3 bits (85), Expect = 0.17 Identities = 15/22 (68%), Positives = 21/22 (95%) Frame = +3 Query: 189 RSFQTTSVTKDIDSAAKFIGAG 254 R FQT+++++DID+AAKFIGAG Sbjct: 58 REFQTSAISRDIDTAAKFIGAG 79 >UniRef50_P05496 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=16; Eutheria|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Homo sapiens (Human) Length = 136 Score = 63.7 bits (148), Expect = 4e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 Score = 43.2 bits (97), Expect = 0.006 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 7/58 (12%) Frame = +3 Query: 102 CNSALVRPLAAV----PTHTQMVPAV---PTQLSAVRSFQTTSVTKDIDSAAKFIGAG 254 C L+RP++A P ++ P+ P Q+ A R FQT+ V++DID+AAKFIGAG Sbjct: 17 CTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQV-ARREFQTSVVSRDIDTAAKFIGAG 73 >UniRef50_P48880 Cluster: ATP synthase protein 9, mitochondrial; n=4; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Chondrus crispus (Carragheen) Length = 76 Score = 55.2 bits (127), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 FGSL++ YARNPSLKQQLF Y ILGFAL+E Sbjct: 31 FGSLVMAYARNPSLKQQLFGYTILGFALTE 60 >UniRef50_UPI0000E25CD7 Cluster: PREDICTED: hypothetical protein isoform 2; n=1; Pan troglodytes|Rep: PREDICTED: hypothetical protein isoform 2 - Pan troglodytes Length = 80 Score = 54.4 bits (125), Expect = 2e-06 Identities = 25/66 (37%), Positives = 39/66 (59%) Frame = -2 Query: 433 EQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTSYSHCR* 254 E ++ HH+ + H L +G+ Q+GV E+LLL+ VPGI +DE + N S S+ +C Sbjct: 8 EDEKGHHQAKAPHGLSEGKAQSGVGEELLLQRRVPGITNDEAPKHSPNLSRRASHPNCGS 67 Query: 253 PAPMNL 236 P+ L Sbjct: 68 PSSNEL 73 >UniRef50_Q01554 Cluster: ATP synthase protein 9, mitochondrial; n=22; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Trichophyton rubrum Length = 74 Score = 50.0 bits (114), Expect = 5e-05 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 FG+LI+G ARNPSL+ LFSYAILGFA SE Sbjct: 28 FGALILGVARNPSLRGLLFSYAILGFAFSE 57 >UniRef50_UPI0000D573BE Cluster: PREDICTED: similar to CG13320-PA, isoform A; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG13320-PA, isoform A - Tribolium castaneum Length = 378 Score = 48.0 bits (109), Expect = 2e-04 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +3 Query: 171 TQLSAVRSFQTTSVTKDIDSAAKFIGAG 254 T L AVRSFQTT V++DIDSAAKFIGAG Sbjct: 30 TLLPAVRSFQTTPVSRDIDSAAKFIGAG 57 >UniRef50_P60112 Cluster: ATP synthase protein 9, mitochondrial; n=72; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Arabidopsis thaliana (Mouse-ear cress) Length = 85 Score = 46.0 bits (104), Expect = 9e-04 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 F SLI ARNPSL +QLF YAILGFAL+E Sbjct: 39 FSSLIHSVARNPSLAKQLFGYAILGFALTE 68 >UniRef50_Q4Q9E5 Cluster: ATPase subunit 9, putative; n=15; Trypanosomatidae|Rep: ATPase subunit 9, putative - Leishmania major Length = 252 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 FG L+IG AR P+L + LF+YAILGFAL+E Sbjct: 207 FGCLLIGCARQPNLTKMLFNYAILGFALTE 236 >UniRef50_P00842 Cluster: ATP synthase protein 9, mitochondrial precursor; n=14; Pezizomycotina|Rep: ATP synthase protein 9, mitochondrial precursor - Neurospora crassa Length = 147 Score = 44.0 bits (99), Expect = 0.003 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 F +L+ G ARNP+L+ QLFSYAILGFA E Sbjct: 102 FAALLNGVARNPALRGQLFSYAILGFAFVE 131 >UniRef50_UPI0000EBC8A1 Cluster: PREDICTED: hypothetical protein; n=2; Eutheria|Rep: PREDICTED: hypothetical protein - Bos taurus Length = 105 Score = 43.6 bits (98), Expect = 0.005 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 318 MMREPKTVPIPAPEPATPTVA 256 MMR P TVPIPAPEPATPTVA Sbjct: 1 MMRLPNTVPIPAPEPATPTVA 21 Score = 35.5 bits (78), Expect = 1.2 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 6/59 (10%) Frame = -2 Query: 253 PAPMNLAAESMSLVTDVVWKDRTAESCV----GTAGTICVWVGTAASGR--TSAELQKM 95 PAPMNLAA SMSL +VWK R S V GT + + SGR T+A+ ++ Sbjct: 23 PAPMNLAAVSMSLEMALVWKLRLGVSEVVRGRGTTAKLLWLSSVSVSGRLTTTADSDRL 81 >UniRef50_A6RZ18 Cluster: Lipid-binding protein; n=2; Sclerotiniaceae|Rep: Lipid-binding protein - Botryotinia fuckeliana B05.10 Length = 149 Score = 41.9 bits (94), Expect = 0.014 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 F +L+ ARNPS++ QLFSYAILGFA E Sbjct: 104 FAALLQAVARNPSMRGQLFSYAILGFAFVE 133 >UniRef50_A3E3Y1 Cluster: Lipid-binding protein; n=1; Karlodinium micrum|Rep: Lipid-binding protein - Karlodinium micrum (Dinoflagellate) Length = 130 Score = 39.5 bits (88), Expect = 0.075 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 F +L++G ARNPS+K+ LF+Y ++G E Sbjct: 84 FAALVVGMARNPSMKEDLFTYTLIGMGFLE 113 >UniRef50_Q7RI18 Cluster: ATPase subunit 9, putative; n=4; Plasmodium|Rep: ATPase subunit 9, putative - Plasmodium yoelii yoelii Length = 189 Score = 37.5 bits (83), Expect = 0.30 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 F +L++G +RNPS+K +LF+Y ++G E Sbjct: 120 FSALVLGTSRNPSIKDELFTYTLIGMGFLE 149 >UniRef50_Q4N435 Cluster: ATP synthase F0, subunit C, putative; n=3; Piroplasmida|Rep: ATP synthase F0, subunit C, putative - Theileria parva Length = 163 Score = 37.1 bits (82), Expect = 0.40 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 F +L+ G ARNPS+K+ LF+Y ++G E Sbjct: 118 FAALVSGTARNPSIKEDLFTYTLIGMGFLE 147 >UniRef50_Q37315 Cluster: ATP synthase protein 9, mitochondrial; n=11; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Dictyostelium discoideum (Slime mold) Length = 88 Score = 35.5 bits (78), Expect = 1.2 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 F + I+ NP+L+ +LF A+LGFALSE Sbjct: 43 FAAFILAVGMNPNLRGELFKLAMLGFALSE 72 >UniRef50_A6R851 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 456 Score = 35.1 bits (77), Expect = 1.6 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +2 Query: 80 CSQVCHLLQL--CTGATTCSSTHPYTDGTCCPYTALCSAVLP 199 C Q HL + C + P+ DGTCCP+ +L +P Sbjct: 57 CDQAIHLFHVKETLYLLRCRQSTPHLDGTCCPHLSLADGAIP 98 >UniRef50_Q8NHP8 Cluster: LAMA-like protein 2 precursor; n=24; Deuterostomia|Rep: LAMA-like protein 2 precursor - Homo sapiens (Human) Length = 589 Score = 34.3 bits (75), Expect = 2.8 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 1/92 (1%) Frame = +1 Query: 148 HRWYLLSLHSSLQCGPSRPHRSLRTLTLLPNSLVLVSDSGSSWFRSWYWNSLRLPHHRLC 327 ++W ++ + + GPS R L L +P +V+V+D S ++ YW S +P Sbjct: 376 NQWMIVDYKAFIPGGPSPGSRVLTILEQIP-GMVVVADKTSELYQKTYWASYNIPSFE-- 432 Query: 328 QEPLPQAAVVLIRHSGFR-LV*GYGSVLSYDG 420 + SG + LV YG SYDG Sbjct: 433 ---------TVFNASGLQALVAQYGDWFSYDG 455 >UniRef50_Q1DF55 Cluster: Dual specificity phosphatase; n=1; Myxococcus xanthus DK 1622|Rep: Dual specificity phosphatase - Myxococcus xanthus (strain DK 1622) Length = 193 Score = 33.9 bits (74), Expect = 3.7 Identities = 19/41 (46%), Positives = 21/41 (51%) Frame = -3 Query: 189 ALQRAV*GQQVPSVYGWVLLQVVAPVQSCRRWQTWLQGRSV 67 AL R V VP V GWV QV+ V C W T L GR + Sbjct: 4 ALLREV--HHVPGVRGWVRKQVLRSVARCVEWTTKLPGRGL 42 >UniRef50_Q8SVL2 Cluster: Putative uncharacterized protein ECU05_0540; n=1; Encephalitozoon cuniculi|Rep: Putative uncharacterized protein ECU05_0540 - Encephalitozoon cuniculi Length = 3436 Score = 33.9 bits (74), Expect = 3.7 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -1 Query: 263 LSLTSTNEFGSRV-NVLSDRCGLEGPHCRELCRDSRYHLCMGGYCC 129 LS TS EFGSRV NVL C L G C+E DS L C Sbjct: 319 LSKTSYIEFGSRVSNVLFSSCSLVGRLCKESSGDSNKGLLFEERIC 364 >UniRef50_Q7WJB6 Cluster: Flagellar hook-length control protein; n=2; Bordetella|Rep: Flagellar hook-length control protein - Bordetella bronchiseptica (Alcaligenes bronchisepticus) Length = 447 Score = 33.1 bits (72), Expect = 6.5 Identities = 22/72 (30%), Positives = 35/72 (48%) Frame = +3 Query: 126 LAAVPTHTQMVPAVPTQLSAVRSFQTTSVTKDIDSAAKFIGAGQRQWE*LVPELVLEQSS 305 LAA+ T PA+P Q + + + +V + +A + GA RQ L+ Q + Sbjct: 114 LAALAAQTAPAPALPLQALEIAA-EAAAVNAQVAAATQAAGAAARQPAHAA--LLAGQPA 170 Query: 306 APSSSAMPGTPP 341 AP++ A G PP Sbjct: 171 APAAPAAAGAPP 182 >UniRef50_A7NYC2 Cluster: Chromosome chr6 scaffold_3, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr6 scaffold_3, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 435 Score = 33.1 bits (72), Expect = 6.5 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -3 Query: 423 NAIIRQNRPIASDKA-KPRMAYENNCCLREGFLA*PMMREPKTVPIPAPEPATPT 262 NA +Q +P + + +P++A EN C + + P P +P P P P T T Sbjct: 71 NADAKQQKPTNTVRTPEPKLAVENLCPRSDSPESAPRKERPARIPKPPPRPTTAT 125 >UniRef50_Q7PQV9 Cluster: ENSANGP00000003034; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000003034 - Anopheles gambiae str. PEST Length = 1366 Score = 33.1 bits (72), Expect = 6.5 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = -3 Query: 399 PIASDKAKPRMAYENNCCLREGFLA*PMMREPKTVPI--PAPEPATPTVADQH 247 P+A +AK R + L + F PM PK PI PAP TP+ H Sbjct: 166 PVALREAKNRQQLSSLALLGQEFWRYPMASSPKPKPITGPAPPGTTPSATSSH 218 >UniRef50_Q17AJ3 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 839 Score = 33.1 bits (72), Expect = 6.5 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 217 RTLTLLPNSLVLVSDSGSSWFRSWYWNS 300 R +TL P L V++SGSSW YW S Sbjct: 613 RKVTLSPPQLGTVAESGSSWIAGGYWGS 640 >UniRef50_UPI000065F4A6 Cluster: Homolog of Homo sapiens "Keratin associated protein 5-9; n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens "Keratin associated protein 5-9 - Takifugu rubripes Length = 191 Score = 32.7 bits (71), Expect = 8.6 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +2 Query: 53 AVCRQTDRPCSQV-CHLLQLCTGATTCSSTHPYTDGTCCPYTALCSAVLP 199 A CR CS CH L LC G + C P C +LC +++P Sbjct: 120 APCRGLSPCCSLASCHGLSLCHGLSLCRGLSPCCSLAPCRGLSLCHSLIP 169 >UniRef50_Q5FRW6 Cluster: ATP synthase C chain; n=4; Rhodospirillales|Rep: ATP synthase C chain - Gluconobacter oxydans (Gluconobacter suboxydans) Length = 85 Score = 32.7 bits (71), Expect = 8.6 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 302 FGSLIIGYARNPSLKQQLFSYAILGFALSE 391 F +LI ARNP+ + +F +LGFAL+E Sbjct: 40 FSTLISSVARNPASRPHVFGIGMLGFALTE 69 >UniRef50_Q1NQF8 Cluster: Putative uncharacterized protein; n=1; delta proteobacterium MLMS-1|Rep: Putative uncharacterized protein - delta proteobacterium MLMS-1 Length = 216 Score = 32.7 bits (71), Expect = 8.6 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +1 Query: 133 QYPPIHR-WYLLSLHSSLQCGPSRPHRSLRTLTLLPN-SLVLVSDSGSSWFRSWYWNSLR 306 Q+ HR W L+ + + G + T+ L+P +++ D GSSW+R + L Sbjct: 50 QHEDSHRPWSFLAGYGTSHPGWGETRTRVETVDLIPRYERIVLDDLGSSWYRGRHSLLLE 109 Query: 307 LPHH 318 LP H Sbjct: 110 LPIH 113 >UniRef50_Q06G99 Cluster: Putative uncharacterized protein; n=1; Rhodococcus sp. NS1|Rep: Putative uncharacterized protein - Rhodococcus sp. NS1 Length = 236 Score = 32.7 bits (71), Expect = 8.6 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 309 EPKTVPIPAPEPATPTVADQH 247 +P T P+P P PAT T+AD H Sbjct: 156 DPHTDPLPLPRPATDTIADLH 176 >UniRef50_Q0CN36 Cluster: Predicted protein; n=2; Aspergillus|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 765 Score = 32.7 bits (71), Expect = 8.6 Identities = 20/62 (32%), Positives = 30/62 (48%) Frame = -2 Query: 310 GAEDCSNTSSGTSYSHCR*PAPMNLAAESMSLVTDVVWKDRTAESCVGTAGTICVWVGTA 131 G D S SS Y+ + ++ + S + +++W D A S VGT G V +G A Sbjct: 587 GVADYSGKSSNAMYARWQ---RLSEKPNTTSAIINLIWTDLVANSVVGTRGWSSVDMGPA 643 Query: 130 AS 125 AS Sbjct: 644 AS 645 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 708,091,702 Number of Sequences: 1657284 Number of extensions: 15245144 Number of successful extensions: 57248 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 51399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56931 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53719013270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -