BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00112 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 27 0.73 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 27 0.73 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 27 0.73 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 27 0.73 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 2.2 AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 25 2.2 AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding pr... 25 2.2 CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 25 3.0 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 25 3.0 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 24 5.2 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 24 5.2 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 6.8 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 6.8 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 6.8 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 23 9.0 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 9.0 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 26.6 bits (56), Expect = 0.73 Identities = 13/55 (23%), Positives = 29/55 (52%) Frame = -2 Query: 535 TFDSMAVHSDSIH*NLICRMAVVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQ 371 T S +++S+H + + ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 214 TISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 26.6 bits (56), Expect = 0.73 Identities = 13/55 (23%), Positives = 29/55 (52%) Frame = -2 Query: 535 TFDSMAVHSDSIH*NLICRMAVVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQ 371 T S +++S+H + + ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 214 TISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 26.6 bits (56), Expect = 0.73 Identities = 13/55 (23%), Positives = 29/55 (52%) Frame = -2 Query: 535 TFDSMAVHSDSIH*NLICRMAVVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQ 371 T S +++S+H + + ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 166 TISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQQHPSSHQQQSQ 220 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 26.6 bits (56), Expect = 0.73 Identities = 13/55 (23%), Positives = 29/55 (52%) Frame = -2 Query: 535 TFDSMAVHSDSIH*NLICRMAVVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQ 371 T S +++S+H + + ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 214 TISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 2.2 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 182 RELCRDSRYHLCMGGY-CCKWSHQC 111 ++LC +++ L MGG+ KW+ C Sbjct: 882 KQLCEETKAALAMGGFPLRKWASNC 906 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 25.0 bits (52), Expect = 2.2 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -2 Query: 313 EGAEDCSNTSSGTSYSHCR*PAPMNLAAESMSLVT--DVV------WKDRTAESCVGTAG 158 +GAEDCS++ TS H + + +S+ L+ D+V + DR GTA Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLLNGDDLVEAKVQEYIDRLEGDWKGTAK 110 Query: 157 TI 152 TI Sbjct: 111 TI 112 >AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding protein OBP5470 protein. Length = 144 Score = 25.0 bits (52), Expect = 2.2 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -2 Query: 313 EGAEDCSNTSSGTSYSHCR*PAPMNLAAESMSLVT--DVV------WKDRTAESCVGTAG 158 +GAEDCS++ TS H + + +S+ L+ D+V + DR GTA Sbjct: 14 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLLNGDDLVEAKVQEYIDRLEGDWKGTAK 73 Query: 157 TI 152 TI Sbjct: 74 TI 75 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 461 EHYYCHPTYEVSVYTIGVDSHGIECLETS 547 EH CH V I D+H +EC+ S Sbjct: 150 EHQLCHLANIKLVVGIDEDTHELECVNIS 178 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 313 EGAEDCSNTSSGTSYSHCR*PAPMNLAAESMSLV 212 +GAEDCS++ TS H + + +S+ L+ Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLL 84 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 23.8 bits (49), Expect = 5.2 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -3 Query: 609 CIPVDAHCRCXIHQSLHHYE 550 C+P + HC +H + YE Sbjct: 183 CLPDEDHCMKLLHAQIDQYE 202 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.8 bits (49), Expect = 5.2 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +1 Query: 91 LPSSATLHWCDHLQQYPPIHRWYLLSLHSSLQCGPSRPH 207 LP SAT W Q+ P H ++ SS Q PH Sbjct: 19 LPYSATTGWYPSNYQHQPPHPQFIGDGESSPQPAMYYPH 57 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 6.8 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -1 Query: 209 RCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAE 99 RCGL G R +++ LC G + S R A+ Sbjct: 533 RCGLTGHKARSCQNEAKCALCGGAHHIGHSECARSAQ 569 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 6.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 260 SLTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSRYHL 150 SL +T V S + +EG HCRE CR ++L Sbjct: 451 SLDNTPSCDPVTGVCSCKENVEGRHCRE-CRLGYFNL 486 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 6.8 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 113 CRVAEDGRPGCRGDQSG 63 C E G+ CRGD G Sbjct: 304 CAGGEKGKDSCRGDSGG 320 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 686 FFFFFLMFYVQHFIADFCLYYIIK 615 F FF F + +FCLY + K Sbjct: 309 FIFFVAGFETSSTVMNFCLYELAK 332 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 9.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 191 PHCRELCRDSRYH 153 P CR +C D+R H Sbjct: 858 PICRAICEDTRVH 870 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 764,844 Number of Sequences: 2352 Number of extensions: 16899 Number of successful extensions: 63 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -