BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00110 (706 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F7.13c |rpl801|rpl8-1, rpl18, rpk5a, rpl2-1, SPAC21E11.02c|... 38 0.002 SPBC2F12.07c |rpl802|rpl8-2, rpk37, rpk5b|60S ribosomal protein ... 38 0.002 SPBC839.04 |rpl803|rpl8-3, rpk5-b, rpkD4|60S ribosomal protein L... 38 0.002 SPBC56F2.08c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 25 8.0 >SPAC1F7.13c |rpl801|rpl8-1, rpl18, rpk5a, rpl2-1, SPAC21E11.02c|60S ribosomal protein L8|Schizosaccharomyces pombe|chr 1|||Manual Length = 253 Score = 37.5 bits (83), Expect = 0.002 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = +1 Query: 550 MGRVIRAQRKGAGSVFVSHT*KRKGAPKL 636 MGRVIRAQRK +G +F +HT RKGA +L Sbjct: 1 MGRVIRAQRK-SGGIFQAHTRLRKGAAQL 28 Score = 36.3 bits (80), Expect = 0.004 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = +2 Query: 611 RRGKALLNYRSLDYAERHGYIKGVVK 688 R+G A L R+LD+AERHGYI+GVV+ Sbjct: 22 RKGAAQL--RTLDFAERHGYIRGVVQ 45 >SPBC2F12.07c |rpl802|rpl8-2, rpk37, rpk5b|60S ribosomal protein L8|Schizosaccharomyces pombe|chr 2|||Manual Length = 253 Score = 37.5 bits (83), Expect = 0.002 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = +1 Query: 550 MGRVIRAQRKGAGSVFVSHT*KRKGAPKL 636 MGRVIRAQRK +G +F +HT RKGA +L Sbjct: 1 MGRVIRAQRK-SGGIFQAHTRLRKGAAQL 28 Score = 36.3 bits (80), Expect = 0.004 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = +2 Query: 611 RRGKALLNYRSLDYAERHGYIKGVVK 688 R+G A L R+LD+AERHGYI+GVV+ Sbjct: 22 RKGAAQL--RTLDFAERHGYIRGVVQ 45 >SPBC839.04 |rpl803|rpl8-3, rpk5-b, rpkD4|60S ribosomal protein L8|Schizosaccharomyces pombe|chr 2|||Manual Length = 253 Score = 37.5 bits (83), Expect = 0.002 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = +1 Query: 550 MGRVIRAQRKGAGSVFVSHT*KRKGAPKL 636 MGRVIRAQRK +G +F +HT RKGA +L Sbjct: 1 MGRVIRAQRK-SGGIFQAHTRLRKGAAQL 28 Score = 36.3 bits (80), Expect = 0.004 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = +2 Query: 611 RRGKALLNYRSLDYAERHGYIKGVVK 688 R+G A L R+LD+AERHGYI+GVV+ Sbjct: 22 RKGAAQL--RTLDFAERHGYIRGVVQ 45 >SPBC56F2.08c |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 661 Score = 25.4 bits (53), Expect = 8.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 179 QPALLFLRSIISKFVNAKRSIWILLVNWFISAKFFLN 289 Q AL+ II+ + A S +LL+ W + FF N Sbjct: 330 QQALVVASIIINSHLLATNSNGMLLLTWLLDNSFFRN 366 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,689,320 Number of Sequences: 5004 Number of extensions: 52313 Number of successful extensions: 150 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -