BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00105 (806 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 1.6 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 8.7 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 584 NRNKMADQNSIPTNADSTRTPV-PFYFCCTECI 679 N + A+ N+IPTNA +T + F + C + + Sbjct: 1015 NSSVNANTNNIPTNAGTTPGAILAFSWACNDAV 1047 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/21 (38%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 376 RLLKQ-NVTLYKWHHYVVERE 317 +L K+ N T + W+H ++RE Sbjct: 159 KLCKEANKTAFLWYHIKIDRE 179 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,652 Number of Sequences: 336 Number of extensions: 3481 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -