BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00104 (711 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 27 0.58 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 27 0.58 L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 25 2.3 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 25 2.3 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 25 2.3 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 3.1 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 9.5 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 23 9.5 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 27.1 bits (57), Expect = 0.58 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 702 SSSCTGSVCPRAAPGPCRTCRN 637 SSSC S+ PR P C CRN Sbjct: 26 SSSCNNSLNPRTPPN-CARCRN 46 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 27.1 bits (57), Expect = 0.58 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 702 SSSCTGSVCPRAAPGPCRTCRN 637 SSSC S+ PR P C CRN Sbjct: 26 SSSCNNSLNPRTPPN-CARCRN 46 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 25.0 bits (52), Expect = 2.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 612 WPKMVKNEGYGTFYKG 659 W K+ K EG G F+KG Sbjct: 260 WVKIGKQEGSGAFFKG 275 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 25.0 bits (52), Expect = 2.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 612 WPKMVKNEGYGTFYKG 659 W K+ K EG G F+KG Sbjct: 260 WVKIGKQEGSGAFFKG 275 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 25.0 bits (52), Expect = 2.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 612 WPKMVKNEGYGTFYKG 659 W K+ K EG G F+KG Sbjct: 260 WVKIGKQEGSGAFFKG 275 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 24.6 bits (51), Expect = 3.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 588 FREHPPRAWPKMVKNEG 638 F +HPP WP+ EG Sbjct: 387 FPQHPPLVWPEAADIEG 403 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 23.0 bits (47), Expect = 9.5 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = -1 Query: 702 SSSCTGSVCPRAAPGPCRTCRNLRS*PSSATLAE--GARETRH--GLDTDLSASMG 547 S SC SVC + C TC +S + A G++ H GL D + +G Sbjct: 21 SCSCHSSVCAVSFVMQCSTCNAPTDSANSVSCAGVCGSKHHTHCTGLSRDSTRELG 76 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +2 Query: 509 SASAEFIADIALSPMEALRSVSKPCLVSRAPSASV 613 SAS ++ ++SP+++L +K L++ A +A+V Sbjct: 101 SASTSNSSNASVSPVKSLNGSTKGLLLAAAAAAAV 135 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 727,728 Number of Sequences: 2352 Number of extensions: 14744 Number of successful extensions: 44 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -