BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00104 (711 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 116 2e-26 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 102 3e-22 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 64 9e-11 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 35 0.061 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 33 0.14 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 32 0.33 At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (D... 31 0.57 At5g23940.1 68418.m02811 transferase family protein similar to a... 31 0.75 At4g24570.1 68417.m03521 mitochondrial substrate carrier family ... 31 1.00 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 30 1.7 At4g16900.1 68417.m02551 disease resistance protein (TIR-NBS-LRR... 29 2.3 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 29 2.3 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 29 3.0 At2g34710.1 68415.m04263 homeobox-leucine zipper transcription f... 29 4.0 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 28 5.3 At5g02340.1 68418.m00157 DC1 domain-containing protein contains ... 28 5.3 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 28 5.3 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 28 7.0 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 28 7.0 At1g74960.2 68414.m08700 3-ketoacyl-ACP synthase, putative simil... 28 7.0 At1g74960.1 68414.m08699 3-ketoacyl-ACP synthase, putative simil... 28 7.0 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 28 7.0 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 27 9.3 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 116 bits (279), Expect = 2e-26 Identities = 56/128 (43%), Positives = 70/128 (54%), Gaps = 1/128 (0%) Frame = +3 Query: 330 VSVREEGVRGLAN*WAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRTFVYLAA 509 + ++E+GV+G W PT +GYS QG CKFGFYE FK Y+ + E Y+T +YLA Sbjct: 122 ILLKEQGVKGFFRGWVPTLLGYSAQGACKFGFYEYFKKTYSDLAGPEYTAKYKTLIYLAG 181 Query: 510 LRRRNSSPTSPCRPWRR*G-PYPNHAWFREHPPRAWPKMVKNEGYGTFYKGLVPLWGRQI 686 P+ F +PK +K+EGYG YKGL PLWGRQI Sbjct: 182 SASAEIIADIALCPFEAVKVRVQTQPGFARGMSDGFPKFIKSEGYGGLYKGLAPLWGRQI 241 Query: 687 PYTMMKFA 710 PYTMMKFA Sbjct: 242 PYTMMKFA 249 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +1 Query: 259 PLXLVKCRLQVDAEKYKNVVNG 324 PL LVKC +Q+D KYK++ +G Sbjct: 98 PLDLVKCNMQIDPAKYKSISSG 119 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 102 bits (244), Expect = 3e-22 Identities = 51/129 (39%), Positives = 73/129 (56%), Gaps = 1/129 (0%) Frame = +3 Query: 327 KVSVREEGVRGLAN*WAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRTFVYLA 506 K +++E+G++G W+PT +GYS QG K+G YE K Y+ ++ E A Y+T +YLA Sbjct: 110 KTTIKEQGLKGFTRGWSPTLLGYSAQGAFKYGLYEYAKKYYSDIVGPEYAAKYKTLIYLA 169 Query: 507 -ALRRRNSSPTSPCRPWRR*GPYPNHAWFREHPPRAWPKMVKNEGYGTFYKGLVPLWGRQ 683 + + + C F PK++K+EG+ +KGLVPLWGRQ Sbjct: 170 GSASAEIVADVALCPMEAVKVRVQTQPGFARGLSDGLPKIIKSEGFRGLHKGLVPLWGRQ 229 Query: 684 IPYTMMKFA 710 IPYTMMKFA Sbjct: 230 IPYTMMKFA 238 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +2 Query: 506 GSASAEFIADIALSPMEALR 565 GSASAE +AD+AL PMEA++ Sbjct: 170 GSASAEIVADVALCPMEAVK 189 Score = 31.9 bits (69), Expect = 0.43 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 259 PLXLVKCRLQVDAEKYKNVVNGLR 330 PL ++KC +Q+D KYKN+ + + Sbjct: 87 PLDVIKCNMQIDPLKYKNITSAFK 110 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +2 Query: 134 TGGMAASAAVPTESCEFGSPKYFAXXXXXXXXXXXXTHTAGCP 262 + G + + A P E E SP YFA THTA P Sbjct: 45 SNGTSFAIATPNEKVEMYSPAYFAACTVAGMLSCGITHTAITP 87 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 64.1 bits (149), Expect = 9e-11 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 1/126 (0%) Frame = +3 Query: 336 VREEGVRGLAN*WAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRTFVY-LAAL 512 +RE G L W+ +GY +QG C+FG YE FK Y+ +L + RT +Y L++ Sbjct: 64 LREHGHSYLWRGWSGKLLGYGVQGGCRFGLYEYFKTLYSDVLPNHN----RTSIYFLSSA 119 Query: 513 RRRNSSPTSPCRPWRR*GPYPNHAWFREHPPRAWPKMVKNEGYGTFYKGLVPLWGRQIPY 692 + + + C F + +P++ ++EG F++GL PLW R +P+ Sbjct: 120 SAQIFADMALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEGLAGFHRGLFPLWCRNLPF 179 Query: 693 TMMKFA 710 +M+ F+ Sbjct: 180 SMVMFS 185 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 34.7 bits (76), Expect = 0.061 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +3 Query: 618 KMVKNEGYGTFYKGLVPLWGRQIPYTMMKF 707 KMV EG YKGLVP RQ P+TM+ F Sbjct: 293 KMVAEEGPMALYKGLVPTATRQGPFTMILF 322 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 618 KMVKNEGYGTFYKGLVPLWGRQIPYTMMKF 707 K VK EG + YKG +P RQ P+T++ F Sbjct: 269 KTVKAEGIMSLYKGFIPTVSRQAPFTVVLF 298 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 32.3 bits (70), Expect = 0.33 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 609 AWPKMVKNEGYGTFYKGLVPLWGRQIPYTMMKF 707 A+ K V++EG+G YKGLVP + +P + F Sbjct: 302 AFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAF 334 >At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (DTC) identical to dicarboxylate/tricarboxylate carrier [Arabidopsis thaliana] GI:19913113 Length = 298 Score = 31.5 bits (68), Expect = 0.57 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 621 MVKNEGYGTFYKGLVPLWGRQIPYT 695 M+KNEG G FYKGL RQ YT Sbjct: 56 MLKNEGVGAFYKGLSAGLLRQATYT 80 >At5g23940.1 68418.m02811 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 484 Score = 31.1 bits (67), Expect = 0.75 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 371 SIGQTADALLADRHLKPFTTFLYFSASTWRRHFTXSRGTRP 249 +I A++++ KPF+TF ++ W RH T +RG +P Sbjct: 252 TIKSRANSVIPSDSSKPFSTFQSLTSHIW-RHVTLARGLKP 291 >At4g24570.1 68417.m03521 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 30.7 bits (66), Expect = 1.00 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +3 Query: 618 KMVKNEGYGTFYKGLVPLWGRQIPYTMMKF 707 K VK EG YKG VP RQ P+T++ F Sbjct: 271 KTVKAEGAMALYKGFVPTVCRQGPFTVVLF 300 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = -2 Query: 704 LHHRVRDLSAPERHQALVERAVTFVLDHL--RPRSRRVLAKP 585 LHHR+R + P RH+ L+ R T +HL PR+ + A P Sbjct: 645 LHHRLRHI-LPSRHRHLLRRKHTIHRNHLHHNPRNLQFTALP 685 >At4g16900.1 68417.m02551 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1072 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +1 Query: 226 SVMRSDPHGRVPLX--LVKCRLQVDAEKYKNVVNGLRCRSARRASAVWPID 372 S++R P G + + L K +++D K K V G+R +A R+ + PID Sbjct: 455 SLIRITPDGDIEMHNLLEKLGIEIDRAKSKETVLGIRFCTAFRSKELLPID 505 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 336 VREEGVRGLAN*WAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDE 470 ++ EGV+GL +F+G + + FG Y K+ G L D+ Sbjct: 65 LQTEGVKGLYRGATSSFMGMAFESSLMFGIYSQAKLFLRGTLPDD 109 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 29.1 bits (62), Expect = 3.0 Identities = 31/131 (23%), Positives = 51/131 (38%), Gaps = 3/131 (2%) Frame = +3 Query: 324 LKVSVREEGVRGLAN*WAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRTFV-- 497 LK+ +REEG L AP+ IG + Y+ + AY E T + Sbjct: 247 LKI-IREEGPTELYRGLAPSLIGVVPYAATNYFAYDSLRKAYRSFSKQEKIGNIETLLIG 305 Query: 498 -YLAALRRRNSSPTSPCRPWRR*GPYPNHAWFREHPPRAWPKMVKNEGYGTFYKGLVPLW 674 AL + P R + G ++ + A ++++EG +YKGL P Sbjct: 306 SLAGALSSTATFPLEVARKHMQVGAVSGRVVYK-NMLHALVTILEHEGILGWYKGLGPSC 364 Query: 675 GRQIPYTMMKF 707 + +P + F Sbjct: 365 LKLVPAAGISF 375 >At2g34710.1 68415.m04263 homeobox-leucine zipper transcription factor (HB-14) identical to homeodomain transcription factor (ATHB-14)GP:3132474 GB:Y11122 [Arabidopsis thaliana]; Length = 852 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -1 Query: 234 HDRXXPTPQRAKYLGDPNSQDSVGTAADAAMPPVCSIATGATVDW 100 H + P PQ + D N+ + + A+ A+ S ATG VDW Sbjct: 151 HQQQNPNPQHQQR--DANNPAGLLSIAEEALAEFLSKATGTAVDW 193 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 336 VREEGVRGLAN*WAPTFIGYSMQGLCKFGFYEVFK 440 ++ G+RGL N PT + +FG Y++FK Sbjct: 179 IQSRGIRGLYNGLTPTLVEIVPYAGLQFGTYDMFK 213 >At5g02340.1 68418.m00157 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 631 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/56 (28%), Positives = 24/56 (42%) Frame = +1 Query: 235 RSDPHGRVPLXLVKCRLQVDAEKYKNVVNGLRCRSARRASAVWPIDGLPLSLGIQC 402 R H P L + + + Y+ N CR+ RR S + D L SL ++C Sbjct: 393 RKKHHPLHPHPLTLKVVSIGYDHYRRRGNYFECRACRRQSCGFVYDSLGFSLDLRC 448 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 618 KMVKNEGYGTFYKGLVPLWGRQIPYTMMKF 707 +++ EGY F+KG + +IPYT + F Sbjct: 92 RIINEEGYRAFWKGNLVTVVHRIPYTAVNF 121 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 27.9 bits (59), Expect = 7.0 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +3 Query: 339 REEGVRGLAN*WAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDE 470 R EG+RGL + P IG ++ F FY K YA DDE Sbjct: 59 RLEGLRGLYAGFFPAVIGSTVSWGLYFFFYGRAKQRYARGRDDE 102 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 27.9 bits (59), Expect = 7.0 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 4/111 (3%) Frame = +3 Query: 339 REEGVRGLAN*WAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRTFVYLAALRR 518 R +G+RG PT +G C + Y+ K +Y ++ A + + L AL Sbjct: 206 RADGIRGFYAGLGPTLVGMLPYSTCYYFMYDKMKTSYC-KSKNKKALSRPEMLVLGALAG 264 Query: 519 RNSSPTS-PCRPWRR*GPYPNHAWFREHPPR---AWPKMVKNEGYGTFYKG 659 +S S P R+ A E PP A ++VK EG Y+G Sbjct: 265 LTASTISFPLEVARK--RLMVGALKGECPPNMAAAIAEVVKKEGVMGLYRG 313 >At1g74960.2 68414.m08700 3-ketoacyl-ACP synthase, putative similar to 3-ketoacyl-ACP synthase [Cuphea pulcherrima] gi|3800747|gb|AAC68860; identical to cDNA beta-ketoacyl-ACP synthetase 2 nuclear gene for plastid product GI:14582700 Length = 541 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 492 FVYLAALRRRNSSPTSPCRPW 554 FV AL +RN+ PT RPW Sbjct: 331 FVACRALSQRNNDPTKASRPW 351 >At1g74960.1 68414.m08699 3-ketoacyl-ACP synthase, putative similar to 3-ketoacyl-ACP synthase [Cuphea pulcherrima] gi|3800747|gb|AAC68860; identical to cDNA beta-ketoacyl-ACP synthetase 2 nuclear gene for plastid product GI:14582700 Length = 541 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 492 FVYLAALRRRNSSPTSPCRPW 554 FV AL +RN+ PT RPW Sbjct: 331 FVACRALSQRNNDPTKASRPW 351 >At1g68390.1 68414.m07813 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266; expression supported by MPSS Length = 408 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 504 AALRRRNSSPTSPCRPWRR*GPYPN 578 ++L+RRNS+ T W + GP+PN Sbjct: 328 SSLKRRNSNRTLTWVDWSKGGPHPN 352 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 618 KMVKNEGYGTFYKGLVPLWGRQIPYTMMKF 707 K +K++G FYKG +P +GR + ++ F Sbjct: 258 KTLKSDGPMAFYKGFIPNFGRLGSWNVIMF 287 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,020,297 Number of Sequences: 28952 Number of extensions: 312989 Number of successful extensions: 1013 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1007 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -