BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00103 (782 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G8.12c |||alpha-1,2-mannosyltransferase |Schizosaccharomyce... 25 9.3 >SPAC4G8.12c |||alpha-1,2-mannosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 25.4 bits (53), Expect = 9.3 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = -3 Query: 780 FFFFLELISAHGFI*Q*N-IEFKICTYL----KKVKRNTPNEFKILLHSCFFYSL 631 + F L ++S GF + + F I Y+ + K+N N I LH C F S+ Sbjct: 172 YTFLLAIVSVLGFFTRITFLAFVIAPYIYFSVRCFKKNVNNPKDIFLHLCIFVSV 226 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,856,968 Number of Sequences: 5004 Number of extensions: 53279 Number of successful extensions: 121 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -