BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00096 (769 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 29 0.12 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 25 1.9 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 25 1.9 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 25 3.4 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 24 4.5 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 5.9 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 24 5.9 AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. 23 7.9 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 29.5 bits (63), Expect = 0.12 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 402 TRFRDGSQIVHQIGLGHTNTGIDDRKSALVLVG 304 T+ R+GS I HQ N + DR+ +L+L G Sbjct: 55 TQNRNGSPINHQGNAASANVAVADRQQSLILAG 87 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 25.4 bits (53), Expect = 1.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 567 FTVRPDSGEPLGRGTKIVL 623 FT+ PDSGE L G I+L Sbjct: 236 FTLPPDSGEKLSLGVTILL 254 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 25.4 bits (53), Expect = 1.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 567 FTVRPDSGEPLGRGTKIVL 623 FT+ PDSGE L G I+L Sbjct: 268 FTLPPDSGEKLSLGVTILL 286 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.6 bits (51), Expect = 3.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 567 FTVRPDSGEPLGRGTKIVL 623 FT+ PDSGE L G I+L Sbjct: 253 FTLPPDSGEKLTLGVTILL 271 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 4.5 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 541 CGNLLQEARSQSAQTAVSPLVEVQR--SSFTSKRTWQNSWKNTKSKR 675 C L +++++ A E + S S R WQN W N+ + R Sbjct: 876 CITLEEDSKNFRKSRAGESFTETAKKASRQASMRQWQNEWSNSLNGR 922 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -1 Query: 97 CLHFFRHFLYCFLFNSHKMTRGFLTHVFQS 8 C F HF Y F F+S F +F S Sbjct: 945 CFRLFNHFYYLFDFDS--SLNSFRNRIFSS 972 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.8 bits (49), Expect = 5.9 Identities = 18/65 (27%), Positives = 26/65 (40%) Frame = -2 Query: 492 DQVTGVEANTELSNHADVGTCLKSLHESFSTRFRDGSQIVHQIGLGHTNTGIDDRKSALV 313 D+V G L + + +L E+ S I H++ T G D K LV Sbjct: 34 DEVVGHGRLPTLDDRTQLAYTEATLREAMRIDTLVPSGIAHRVQEDTTLRGYDLPKDTLV 93 Query: 312 LVGND 298 L+G D Sbjct: 94 LIGLD 98 >AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. Length = 190 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 297 DHSQQERGHSYDHRYRYWYDQGRFGEQF 380 D +QE G ++DH +W F F Sbjct: 34 DEQKQELGLNFDHDGEFWMSYRDFTRYF 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 796,633 Number of Sequences: 2352 Number of extensions: 18045 Number of successful extensions: 38 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -