BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00095 (798 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 25 2.0 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 23 8.3 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 25.4 bits (53), Expect = 2.0 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -3 Query: 787 PASAWSSTETTCGRIVLIFTSL--LLRHHDFIVI 692 PA W S++T +VL+F SL +L H ++++ Sbjct: 508 PARLWRSSQTQTLFLVLVFVSLFGVLLTHGYLIM 541 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 383 LNTPLHESDFSGALPQNQVVATPNTVLAT 469 L P H S A P+ VA+P T A+ Sbjct: 109 LRPPFHRPTTSTAAPEGTSVASPTTAEAS 137 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 783,251 Number of Sequences: 2352 Number of extensions: 15937 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -