BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00092 (748 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 25 0.57 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 25 0.57 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 25 0.57 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 25 0.57 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 23 3.0 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 23 4.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 5.3 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 7.0 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 9.3 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 9.3 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 9.3 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 9.3 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 9.3 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 9.3 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 9.3 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 9.3 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 9.3 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 9.3 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 9.3 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 9.3 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 9.3 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 9.3 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 9.3 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 9.3 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 9.3 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 9.3 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 25.4 bits (53), Expect = 0.57 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 214 KNRQTREHLLVFFTIKEFEII 276 KN QTREH L+ FT+ ++I Sbjct: 129 KNGQTREHALLAFTLGVKQLI 149 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 25.4 bits (53), Expect = 0.57 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 214 KNRQTREHLLVFFTIKEFEII 276 KN QTREH L+ FT+ ++I Sbjct: 56 KNGQTREHALLAFTLGVKQLI 76 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 25.4 bits (53), Expect = 0.57 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 214 KNRQTREHLLVFFTIKEFEII 276 KN QTREH L+ FT+ ++I Sbjct: 72 KNGQTREHALLAFTLGVKQLI 92 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 25.4 bits (53), Expect = 0.57 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 214 KNRQTREHLLVFFTIKEFEII 276 KN QTREH L+ FT+ ++I Sbjct: 129 KNGQTREHALLAFTLGVKQLI 149 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 23.0 bits (47), Expect = 3.0 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 210 KEKSTNSRAFTCFLYNQRIRDH*FLPRPV 296 KEK R +C L +R + FL RP+ Sbjct: 1 KEKHLTQRINSCDLLKKRNENDPFLKRPI 29 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.6 bits (46), Expect = 4.0 Identities = 15/59 (25%), Positives = 24/59 (40%) Frame = +1 Query: 187 QTRPSCSRRKNRQTREHLLVFFTIKEFEIIDFFLGPSMNDEVLKIMPVQKQTRAGQRTR 363 +T PS + R+ EH L F ++ + +FL N ++K T Q R Sbjct: 192 ETFPSVYSKTRRRALEHTLDRFHNDKYSNVPYFLFGDFNFRTDTAGVIKKLTEDTQERR 250 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 396 TVILVWV*SAARKSPL 443 T++LVW SAA SP+ Sbjct: 306 TILLVWAISAAIGSPI 321 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 7.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 304 HSWTGRGRNQ*SRIL*L*RKQVNALEFVDFSFANKT 197 ++W G GR+ SR+L L K + + + S A T Sbjct: 483 YAWIGAGRDSDSRLLDLCTKFLMHKDSLGLSTATST 518 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 689 LGKFC*SHICCHCQDIC 739 LG+F + CC D+C Sbjct: 49 LGRFKHTDACCRTHDMC 65 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 689 LGKFC*SHICCHCQDIC 739 LG+F + CC D+C Sbjct: 54 LGRFKHTDACCRTHDMC 70 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 199 SCSRRKNRQTRE 234 SCSR +NR+ RE Sbjct: 236 SCSRDRNREYRE 247 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 689 LGKFC*SHICCHCQDIC 739 LG+F + CC D+C Sbjct: 54 LGRFKHTDACCRTHDMC 70 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 679 STGTWEILLKPHMLPLPRHMPNL 747 + G W I LPLP+H+P + Sbjct: 492 NAGIWMIDFAK-TLPLPQHLPRI 513 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 679 STGTWEILLKPHMLPLPRHMPNL 747 + G W I LPLP+H+P + Sbjct: 407 NAGIWMIDFAK-TLPLPQHLPRI 428 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 679 STGTWEILLKPHMLPLPRHMPNL 747 + G W I LPLP+H+P + Sbjct: 726 NAGIWMIDFAK-TLPLPQHLPRI 747 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,567 Number of Sequences: 438 Number of extensions: 4595 Number of successful extensions: 30 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -