BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00091 (438 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20490.1 68415.m02392 nucleolar RNA-binding Nop10p family pro... 82 2e-16 At2g14455.1 68415.m01618 hypothetical protein 26 9.7 >At2g20490.1 68415.m02392 nucleolar RNA-binding Nop10p family protein similar to Nop10p (GI:8096260) [Homo sapiens] Length = 64 Score = 81.8 bits (193), Expect = 2e-16 Identities = 36/62 (58%), Positives = 46/62 (74%) Frame = +1 Query: 76 MYLRYYLNDKGDREYTLATIDPFGKPTLSAHPARFSPEDKYSRHRIIIKKRFGLLLTQQP 255 MYL+ Y+N+KG++ YT P G T SAHPARFSP+DKYS+ R+++KKRFGLL TQ Sbjct: 1 MYLQCYINEKGEKVYTTKKESPLGLATESAHPARFSPDDKYSKQRVLLKKRFGLLPTQNA 60 Query: 256 NL 261 L Sbjct: 61 PL 62 >At2g14455.1 68415.m01618 hypothetical protein Length = 260 Score = 26.2 bits (55), Expect = 9.7 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +2 Query: 248 NNRTYSLK*ILICIENYQNGLNFDTF*QLFSKSKAHRIYITYNRTQM 388 NN+ + + I++CI ++ +N D + +K HRI T R + Sbjct: 2 NNQNWVICVIVLCIWDHPPNVNGDVTTMILVDAKHHRIVATIPRLNL 48 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,349,312 Number of Sequences: 28952 Number of extensions: 164222 Number of successful extensions: 362 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 692941200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -