Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00090X
         (351 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF317551-1|AAG39634.1|  312|Tribolium castaneum distal-less prot...    21   4.8  
AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.           20   6.4  

>AF317551-1|AAG39634.1|  312|Tribolium castaneum distal-less
           protein.
          Length = 312

 Score = 20.6 bits (41), Expect = 4.8
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 173 GSPSRYPSCSRCG 211
           G+P   P+ SRCG
Sbjct: 291 GTPRTTPASSRCG 303


>AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.
          Length = 312

 Score = 20.2 bits (40), Expect = 6.4
 Identities = 10/36 (27%), Positives = 16/36 (44%)
 Frame = -3

Query: 337 PRRLQPRESRTQWATRHPGAXQSGRPTARATTLARP 230
           P+RL P   ++     HP A      +  +T +A P
Sbjct: 78  PQRLAPTHLQSPNTQTHPSASCKYADSTSSTGVASP 113


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 51,509
Number of Sequences: 336
Number of extensions: 809
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 50
effective length of database: 105,785
effective search space used:  6981810
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)