BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00090X (351 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 1.8 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 3.2 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 3.2 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 20 7.4 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 20 7.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 1.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 195 LAPVAASPPCACGRASVVARAVGRPDCXAPG 287 L P ++ P S ++ A+GR C +PG Sbjct: 273 LNPNSSLQPSLASHHSHLSSALGRSACHSPG 303 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.4 bits (43), Expect = 3.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +3 Query: 180 PRVTPLAPVAASPPCACGRASVVARAVGRPDC 275 P++TP A + ACG A A + C Sbjct: 107 PKLTPYPNWAQNKAGACGSAITTAYRIHADSC 138 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 3.2 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 234 ARTRKGETPQREQE 193 AR +KG TP++++E Sbjct: 172 ARKKKGPTPRQQEE 185 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 146 WLSFFASPLGSPS 184 WL+ SP+GSPS Sbjct: 88 WLANANSPVGSPS 100 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 20.2 bits (40), Expect = 7.4 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 146 WLSFFASPLGSPSR 187 W+SF+ P +P+R Sbjct: 263 WVSFWIKPEAAPAR 276 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 20.2 bits (40), Expect = 7.4 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 Query: 98 GGAVPXSPYRESFYLLWLSFF 160 G A+P PY E+ W F Sbjct: 224 GDAIPTVPYTETETETWTRVF 244 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,171 Number of Sequences: 438 Number of extensions: 1025 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8060325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -