BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00088 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding prot... 73 9e-15 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 5.4 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 9.5 >AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding protein protein. Length = 108 Score = 72.9 bits (171), Expect = 9e-15 Identities = 30/63 (47%), Positives = 42/63 (66%) Frame = +1 Query: 256 QPFTFQIGVGQVIKGWDQGLLDMCVGEKRKLTIPASLGYGERGAGNVIPPHATLHFEVEL 435 +PF F +G G+VI+GWD+G+ M VG++ KL YG RG VIPP+A L F+VEL Sbjct: 45 KPFKFSVGKGEVIRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNARLTFDVEL 104 Query: 436 INI 444 + + Sbjct: 105 LRV 107 Score = 39.1 bits (87), Expect = 1e-04 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +2 Query: 137 EVVSVPEGC-TTKSKHGDMLTMHYTGTLDDGHKFDSSYDR 253 ++V + G TT K G +HYTGTLDDG FDSS R Sbjct: 4 QIVPIANGDQTTFPKPGQTAVVHYTGTLDDGTVFDSSRTR 43 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 5.4 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 476 RKSTPIRTTCSPRRSER-LFEEADGSRRR 559 RK +R T +PR SER L ++ S R Sbjct: 925 RKGPQVRPTLTPRHSERALLSDSTSSSER 953 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.0 bits (47), Expect = 9.5 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +3 Query: 366 GLRRARSRQRDSSPRYIAFRSGVDQHR*LSTGHKRVQGN 482 G RR+RSR R S RSG + K V G+ Sbjct: 1159 GSRRSRSRSRSRSGSRSRSRSGSGSRQASPISRKSVSGS 1197 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 740,788 Number of Sequences: 2352 Number of extensions: 14527 Number of successful extensions: 51 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -