BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00087 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 23 3.1 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 22 4.1 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 22 5.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 7.2 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 9.6 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.6 bits (46), Expect = 3.1 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 67 SSELQCERTVCARQ*GPQQGKANTQQDSRR 156 +S+L+C+R + GPQQ A+ + + R Sbjct: 64 NSDLRCKRKIQFMPYGPQQQPASVARRNAR 93 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 22.2 bits (45), Expect = 4.1 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = -2 Query: 200 RRL*CNWKCRCRPQTRRESCWVFA----FPCCGPY*RAQTVRSHCSSDESLLPCQ 48 + L CN K C+ ++ SC V P C P + CS+D + +P Q Sbjct: 131 KELFCNGKPDCKDESDENSCTVETDPNRAPDCDPT-QCVLPDCFCSADGTRIPGQ 184 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 21.8 bits (44), Expect = 5.5 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = -2 Query: 200 RRL*CNWKCRCRPQTRRESCWVFAFP----CCGPY*RAQTVRSHCSSDESLLPCQ 48 + L CN K C+ ++ SC V P C P + CS+D + +P Q Sbjct: 124 KELFCNGKPDCKDESDENSCTVETDPNRALDCDPT-QCVLPDCFCSADGTRIPGQ 177 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 7.2 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 197 GGVKTVTISTGPISKRCAAASPGLSTPPKDSS 292 G V +T S GP S S G S+P S Sbjct: 112 GNVPPLTPSPGPPSHPYTVISNGYSSPMSSGS 143 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -3 Query: 187 VTGSVAVVHRH 155 VTG++ ++HRH Sbjct: 3 VTGNLGIMHRH 13 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,209 Number of Sequences: 336 Number of extensions: 2910 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -