BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00085 (629 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 100 2e-21 SB_40010| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_58953| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) 28 5.4 SB_44616| Best HMM Match : rve (HMM E-Value=0.012) 28 5.4 SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7) 28 5.4 SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_46518| Best HMM Match : VWA (HMM E-Value=1.6e-07) 28 7.2 SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30) 28 7.2 SB_29064| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_5179| Best HMM Match : Neur_chan_memb (HMM E-Value=3.5e-08) 27 9.5 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 99.5 bits (237), Expect = 2e-21 Identities = 44/80 (55%), Positives = 61/80 (76%) Frame = +1 Query: 19 MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFG 198 MK I+A++ V IPD + V VKSR+VTV GPRG LKRNF+HL +++ V ++V+ WF Sbjct: 557 MKTILASETVTIPDNVEVKVKSRVVTVTGPRGTLKRNFRHLRLELTKVGKDKVRVDVWFA 616 Query: 199 SKKELAAVRTVCSHVENMIK 258 S+KELA V+T+ +H+ENMIK Sbjct: 617 SRKELACVKTIITHIENMIK 636 Score = 78.2 bits (184), Expect = 5e-15 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +3 Query: 255 KGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAP 401 KGV G++YKMRAVYAHFPIN E +++E+RNFLGEKY+RRV+M P Sbjct: 636 KGVIYGYRYKMRAVYAHFPINIAIQENGTLVEVRNFLGEKYVRRVRMRP 684 >SB_40010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = +2 Query: 509 VKNKDIRKFLDGLYVSEKTTVV 574 VKNKDIRKFLDG+YVSEKTT+V Sbjct: 10 VKNKDIRKFLDGVYVSEKTTIV 31 >SB_58953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 338 ITLSGDTVNGEVSIHSTHLVLEAFSYSFIMFS 243 +T+ D G VS H+THLV A S +++ F+ Sbjct: 173 LTIHTDHEGGNVSAHTTHLVGSALSDAYLSFA 204 >SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 180 LQETRVYHANVNSQVFEVPFENSAGPFNCHQ 88 L TR+ + V+S EV E S P++CHQ Sbjct: 160 LYNTRIPNVTVSSDGGEVELEISDDPYDCHQ 190 >SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -1 Query: 233 QTVLTAASSFLDPNHFSTFRRRGFTMRMSTAKCLKFLLRTPRGPLTVT 90 QT++T A F D RRR F+ +S C + L R+P P++ T Sbjct: 85 QTMITTA--FPDTRKSPLTRRRNFSDGVSDLSCTENLARSPCAPVSPT 130 >SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) Length = 883 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 1 VKQSPNMKQIVANQKVKIPDGLTVHVKSRLVTVKGPRG 114 ++ + +K++ + K K DG+ VH K+ TV+ PRG Sbjct: 98 LQNAKRIKKLEEDLKKKTCDGVLVHRKAVAATVEEPRG 135 >SB_44616| Best HMM Match : rve (HMM E-Value=0.012) Length = 1189 Score = 28.3 bits (60), Expect = 5.4 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = +1 Query: 49 KIPDGLTVHVKSRLVTVKGPRG---VLKRNFKHL-AVDIRMVNPRLLKV 183 K+ DGL VH+ ++ V K P+ + KR + L A+ I + +P + KV Sbjct: 4 KLDDGLRVHIVTQYVLFKNPKKLEIIAKRQKETLEALQINLDHPHVAKV 52 >SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7) Length = 197 Score = 28.3 bits (60), Expect = 5.4 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Frame = -3 Query: 171 TRVYHANVNSQVFEVP-------FENSAGPFNCHQTRFHMDRKP 61 TR YH NV VF V F S G N HQ + DR+P Sbjct: 57 TRSYHENVVRPVFGVSDYWYRYEFAKSRGQINRHQLSWREDRQP 100 >SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1427 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +3 Query: 33 SKSESQNPRRAYGPCEIASGDS*RAPRS--SQKELQTL 140 S+ ++ R Y PC I SG++ APR +KE++ L Sbjct: 1363 SEDDTTTGARRYRPCPIESGNTYEAPRQVVMEKEVEEL 1400 >SB_46518| Best HMM Match : VWA (HMM E-Value=1.6e-07) Length = 309 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 457 LPSMISSSFCFGELTTVTPGAIFTLLMYFSPKKLRISIIE 338 +P I S G+L +T G I T PKKL +IE Sbjct: 218 IPIAIGSKVNLGQLNILTAGPIITANTSGDPKKLANQVIE 257 >SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30) Length = 1152 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 76 VKSRLVTVKGPRGVLKRNFKHL 141 V++R TV PRG L+RN +HL Sbjct: 1069 VETRSYTVSTPRGELRRNRRHL 1090 >SB_29064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 27.5 bits (58), Expect = 9.5 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = -2 Query: 487 AAELETSSKELPSMISSSFCFGELTTVTPGAIFTLLMYFSPKKLRISIIEL 335 AAE++TS L + S S C VT IFT MY P+++ ++ L Sbjct: 234 AAEVKTSRIFLLVINSFSICLAPFMIVTFIEIFTGTMYTVPRQVYLATTNL 284 >SB_5179| Best HMM Match : Neur_chan_memb (HMM E-Value=3.5e-08) Length = 428 Score = 27.5 bits (58), Expect = 9.5 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = -1 Query: 302 SIHSTHLVLEAFSYSFIMF--STCEQTVLTAASSFLDPNHFSTFRRRGFTMRMSTAKCLK 129 S+ S HL L Y ++++ + C L +SFL P+H + R GF + A + Sbjct: 185 SVISFHLTLSRKPYYYLLYILTPCSVLCLLTLTSFLIPSH--SGERIGFITTLLLAMTVY 242 Query: 128 FLL 120 LL Sbjct: 243 LLL 245 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,733,398 Number of Sequences: 59808 Number of extensions: 380449 Number of successful extensions: 996 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -