BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00084X (535 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2... 25 7.1 SPBC1861.03 |mak10||NatC N-acetyltransferase complex subunit Mak... 25 9.4 >SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 411 Score = 25.0 bits (52), Expect = 7.1 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = -3 Query: 524 FLVFRSGDLVFSGEGEWY-FSSPRVLF-*RPLRVVGLSF-EIDIERDLDLIMSAL*RSKS 354 F+++RS + +G WY F R +F PL +F E DI ++ LI L R Sbjct: 346 FMIYRSKGIFNKDDGSWYIFQGVREVFEIMPLSEKPRAFLEKDIHPEIILIGRNLHRISP 405 Query: 353 FNAG 342 F G Sbjct: 406 FVVG 409 >SPBC1861.03 |mak10||NatC N-acetyltransferase complex subunit Mak10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 708 Score = 24.6 bits (51), Expect = 9.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 503 DLVFSGEGEWYFSSP 459 DL+ S E EW++ SP Sbjct: 105 DLIVSAEKEWHYGSP 119 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,044,691 Number of Sequences: 5004 Number of extensions: 37540 Number of successful extensions: 68 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -