BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00080 (317 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.3 SB_16077| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.6 >SB_58926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2371 Score = 27.1 bits (57), Expect = 3.3 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 125 LVERFVWLIPVTNETLAC 178 LV RFV ++PVT+ T AC Sbjct: 1290 LVARFVRMLPVTHHTAAC 1307 >SB_16077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 25.8 bits (54), Expect = 7.6 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 67 LTD*QLFLDSVGGGAWPFLVGGAICLVNSGNERDSSLLNRRRYLG 201 +T+ L LD++G W ++ + L +D+SLL RY G Sbjct: 62 VTNEALELDTLGSRGWVRILTSLLLLYGHLAIKDTSLLRTPRYYG 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,118,672 Number of Sequences: 59808 Number of extensions: 162930 Number of successful extensions: 352 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 413004273 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -