BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00080 (317 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23517-11|AAY44017.1| 288|Caenorhabditis elegans Hypothetical p... 27 2.2 AC024791-31|AAF60655.1| 181|Caenorhabditis elegans Hypothetical... 27 2.2 >U23517-11|AAY44017.1| 288|Caenorhabditis elegans Hypothetical protein D1022.9 protein. Length = 288 Score = 27.5 bits (58), Expect = 2.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 4 WSLRLNLTQHGKSHQARTPEGLTD*QLFLD 93 W L L H K + ARTP + D ++F++ Sbjct: 61 WPLMLARFSHEKPYVARTPAAIADAEMFIN 90 >AC024791-31|AAF60655.1| 181|Caenorhabditis elegans Hypothetical protein Y47G6A.3 protein. Length = 181 Score = 27.5 bits (58), Expect = 2.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 6 EPAA*FDSTREISPGPDTGRIDRL 77 EP+A FD+ ++ PG RIDR+ Sbjct: 100 EPSALFDNANDLLPGQKEERIDRM 123 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,547,105 Number of Sequences: 27780 Number of extensions: 115607 Number of successful extensions: 294 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 294 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 366105812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -