BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00078 (707 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U49954-1|AAA93426.1| 388|Caenorhabditis elegans Hypothetical pr... 28 5.7 Z48809-2|CAA88747.1| 406|Caenorhabditis elegans Hypothetical pr... 28 7.5 >U49954-1|AAA93426.1| 388|Caenorhabditis elegans Hypothetical protein Y102E9.2 protein. Length = 388 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 109 DPARRKDDINLLLKMRDEIVRELSLPASFIKDSLF 213 D A D LL+ RDE VR L PA+ + DS F Sbjct: 160 DVAFSPDGKRLLMADRDEKVRALRYPATSVIDSFF 194 >Z48809-2|CAA88747.1| 406|Caenorhabditis elegans Hypothetical protein T01E8.4 protein. Length = 406 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -1 Query: 209 NESLMKLAGSDNSRTISSRIFSSKLMSSFLRAGSGFLLYSSLKRNRSF 66 ++ +KL ++N + + S SFL G+ ++ SLKRN +F Sbjct: 303 SDGKVKLYDANNFNVLQTYSVGSYTRQSFLEHGAHLIMARSLKRNYTF 350 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,133,721 Number of Sequences: 27780 Number of extensions: 294066 Number of successful extensions: 652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -