BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00076 (738 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 26 0.28 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 26 0.28 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 26 0.28 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.9 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 7.9 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 37 RQPIPWARKVKYLGVTLDASMTFRPHIKSVRDRAAF 144 RQ PW RKV G ++ TF P ++ R R A+ Sbjct: 208 RQIYPWMRKVHVAGA---SNGTFAPGMEPKRQRTAY 240 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 37 RQPIPWARKVKYLGVTLDASMTFRPHIKSVRDRAAF 144 RQ PW RKV G ++ TF P ++ R R A+ Sbjct: 208 RQIYPWMRKVHVAGA---SNGTFAPGMEPKRQRTAY 240 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 37 RQPIPWARKVKYLGVTLDASMTFRPHIKSVRDRAAF 144 RQ PW RKV G ++ TF P ++ R R A+ Sbjct: 208 RQIYPWMRKVHVAGA---SNGTFAPGMEPKRQRTAY 240 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 484 ILIMQEPVTSTP*TRPYGSIRSNNL 558 +L MQ+ + P T+PYG+ RS + Sbjct: 543 LLPMQQ--SQNPPTKPYGTCRSEGI 565 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +3 Query: 465 DADYSPNPDHAGASHVDALDTSLRIH 542 D +P P H G + TS R+H Sbjct: 210 DESRTPRPKHDGRGRIVERFTSDRVH 235 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,543 Number of Sequences: 336 Number of extensions: 3285 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -