BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00076 (738 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF036692-9|AAB88330.1| 389|Caenorhabditis elegans Hypothetical ... 33 0.21 >AF036692-9|AAB88330.1| 389|Caenorhabditis elegans Hypothetical protein C44B12.7 protein. Length = 389 Score = 33.1 bits (72), Expect = 0.21 Identities = 21/78 (26%), Positives = 36/78 (46%) Frame = +1 Query: 43 PIPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTL*KT 222 PI + + LG+ D+ +TF+PHIK + + L R ++ + L KT Sbjct: 188 PISPSNIARDLGILTDSKLTFKPHIKKI---VSLALLRCKQLLKSFKSLCPEFYCNLFKT 244 Query: 223 CIRPVMTYASVCSLTRPA 276 I P++ Y S +P+ Sbjct: 245 YILPLIEYGSAVYSPKPS 262 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,070,812 Number of Sequences: 27780 Number of extensions: 321411 Number of successful extensions: 714 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1735436670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -