BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00076 (738 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g33350.1 68415.m04088 hypothetical protein 31 1.1 At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-relate... 28 5.6 >At2g33350.1 68415.m04088 hypothetical protein Length = 440 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 381 ESIRKYMKSASERYFDKAMRHDNRLIVADA 470 E IR+YMK +ER F+K +++ R +AD+ Sbjct: 343 EKIRRYMKKRNERNFNKKIKYACRKTLADS 372 >At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-related similar to glucan endo-1,3-beta-glucosidase precursor SP:P52409 from [Triticum aestivum] Length = 330 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 445 IIALSLPTLTTPRILIMQEPVTSTP*TRPYGSI 543 +I + PTLT P + PVT P T+P G++ Sbjct: 82 VITIPPPTLTPPVTNPVTNPVTQYPPTQPSGTV 114 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,359,492 Number of Sequences: 28952 Number of extensions: 303569 Number of successful extensions: 632 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -