BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00067 (794 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.8 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 22 4.9 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 22 4.9 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 22 4.9 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 6.5 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/35 (22%), Positives = 20/35 (57%) Frame = -3 Query: 732 SWIVQFEGPQEITRVLELFSNSEDLMDESSTQIML 628 SW+ F+G ITR + + S+ + ++ ++++ Sbjct: 915 SWVAPFDGNSPITRYMIEYKQSKVSWEGNTERVLV 949 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 369 PWYQPSFTEVRKVLQLFRLRQINNG 443 P QP+ R + R++Q+NNG Sbjct: 80 PQQQPASVARRNARERNRVKQVNNG 104 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 636 SVLRTHP*DLHCWRKVQ 686 SVL T+ DL C RK+Q Sbjct: 58 SVLVTNNSDLRCKRKIQ 74 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 570 LSLANPRLYTNSRTLF 523 LS A PRL N+RT+F Sbjct: 87 LSSAFPRLKRNARTIF 102 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 200 RRSSAIKKKREIFKRAEQSSRNTA 271 R S KK+RE+ + A+Q + N A Sbjct: 298 RFSDESKKRRELLRLAQQVNANIA 321 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 533 GHSLSWGIPSNVRLGDT*HIHSSLIQTYKHT 441 G+SLSW P ++ + + + + Q HT Sbjct: 174 GNSLSWNNPCSINSTSSQPVGTQIHQQTNHT 204 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,872 Number of Sequences: 336 Number of extensions: 4078 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21583952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -