BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00064 (785 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 25 1.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 4.3 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 5.6 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 9.8 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 24.6 bits (51), Expect = 1.1 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -2 Query: 427 HCGCRTLKCTEMSERPASNSSLPMFIANHGMSS-LGVPVQIICEPIVK 287 H G + KCT E S ++ + I H SS +G P EP ++ Sbjct: 254 HYGEKVYKCTLCHETFGSKKTMELHIKTHSDSSVVGSPRDSPIEPEIE 301 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 4.3 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +1 Query: 607 SLYSSLDRVTGIRDAFLKISKTDNYPTLAPERPEISLTTSI 729 +L +LD++ D KI++ LAP+ +++ TS+ Sbjct: 887 NLTQTLDKLIRSPDTLRKIAQNRGTNPLAPDAVDLTQLTSV 927 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 Query: 96 EEIEKFCKKNNE 131 EEI FC KNN+ Sbjct: 332 EEINTFCPKNNK 343 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 527 EIVVDETETLWAVD 568 +I +DE E LW +D Sbjct: 131 KIAIDEYERLWVLD 144 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,410 Number of Sequences: 438 Number of extensions: 4335 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -