BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00061 (775 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 25 3.4 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 25 3.4 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 4.5 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 6.0 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 7.9 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 24.6 bits (51), Expect = 3.4 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -2 Query: 753 SLLVSNFDKII*V*CYTYFLGVCAWIAIQYFGYGV 649 S+ ++ K++ + T L V AW+ I +FG V Sbjct: 124 SIALAKMRKLLVLVMATTVLSVVAWVTITFFGESV 158 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 24.6 bits (51), Expect = 3.4 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -2 Query: 753 SLLVSNFDKII*V*CYTYFLGVCAWIAIQYFGYGV 649 S+ ++ K++ + T L V AW+ I +FG V Sbjct: 124 SIALAKMRKLLVLVMATTVLSVVAWVTITFFGESV 158 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.2 bits (50), Expect = 4.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 220 HLVLAENVYQRHGEQHQKE 276 H +LAEN Q+H +Q Q++ Sbjct: 891 HKLLAENYRQQHQQQQQQQ 909 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 633 QP*QLLPHNRNTGSQSTHRLQ 695 QP Q LPH + T Q + RLQ Sbjct: 378 QPRQSLPHRKQTQLQLSPRLQ 398 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 475 RCKMGWRYCNIKLDELNLW 531 R K W+Y + LD L LW Sbjct: 644 RVKEDWKYVAMVLDRLFLW 662 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,125 Number of Sequences: 2352 Number of extensions: 14339 Number of successful extensions: 50 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -