BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00061 (775 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 26 0.34 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 2.4 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 22 5.5 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.5 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.5 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 7.3 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 26.2 bits (55), Expect = 0.34 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 560 NLSQWNQMEEFYTNVHVCILGGMLTTVTIIT-P*PKYW 670 +LS W QM + + + VC + + T+T +T P ++W Sbjct: 118 SLSCWLQMTKHHNFIKVCSVNDVNMTITELTDPVKEFW 155 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 475 RCKMGWRYCNIKLDELNLW 531 R K W+Y + LD L LW Sbjct: 501 RVKEDWKYVAMVLDRLFLW 519 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 44 TLIGFYFGEANIR 6 TLI YFGEA+I+ Sbjct: 14 TLIFLYFGEADIK 26 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 475 RCKMGWRYCNIKLDELNLW 531 + K W+Y + LD L LW Sbjct: 506 KVKEDWKYVAMVLDRLFLW 524 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 475 RCKMGWRYCNIKLDELNLW 531 + K W+Y + LD L LW Sbjct: 506 KVKEDWKYVAMVLDRLFLW 524 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 434 PKHFHSGNFVLLKSDVKWDGDTVISN 511 P F N++ +KSD W D + N Sbjct: 108 PSDFDGINYIYVKSDDIWVPDISVYN 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,603 Number of Sequences: 438 Number of extensions: 4124 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -