BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00052 (404 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.43 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 1.00 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 1.00 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 2.3 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 2.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 2.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 2.3 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 2.3 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 4.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 4.0 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 4.0 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 4.0 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 7.0 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 20 9.3 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 20 9.3 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 20 9.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 20 9.3 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 20 9.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 20 9.3 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 20 9.3 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 20 9.3 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 20 9.3 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 24.6 bits (51), Expect = 0.43 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -1 Query: 290 PVIPPHKAVPYRPRSRPASGPAGTPYSQ*GTAVGRPPSPGIN 165 P P + P + P GP G P SQ + + P+ GI+ Sbjct: 31 PQAPQRGSPPNPSQGPPPGGPPGAPPSQNPSQMMISPASGIH 72 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.4 bits (48), Expect = 1.00 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 218 PYSQ*GTAVGRPPSPGINTRCVSSH 144 PY+Q GT V PP+ + V H Sbjct: 894 PYNQRGTVVSPPPTKRRTMKVVKYH 918 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.4 bits (48), Expect = 1.00 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 218 PYSQ*GTAVGRPPSPGINTRCVSSH 144 PY+Q GT V PP+ + V H Sbjct: 932 PYNQRGTVVSPPPTKRRTMKVVKYH 956 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.2 bits (45), Expect = 2.3 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +2 Query: 32 NNNVIFKILNTEHEMYLKLDVNVDRYGDRKTWGSNDSSEKRH 157 N NV+ LN EH + L NV+ + D+ + H Sbjct: 383 NQNVLNNDLNLEHVNFQILGANVNDLIRNSRCANFDNQDNNH 424 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.2 bits (45), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -3 Query: 156 CLFSLESFDPQV-FLSPY 106 C+ S ES++PQV F++ Y Sbjct: 114 CILSSESYNPQVDFVADY 131 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 2.3 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 31 KQQRHLQDTEHRTRDVLETGRERGQIWRQED 123 K Q QDT T+ +L+ IW+Q++ Sbjct: 927 KWQHKSQDTTEVTKYILQYKEGDAGIWQQQE 957 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 2.3 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 31 KQQRHLQDTEHRTRDVLETGRERGQIWRQED 123 K Q QDT T+ +L+ IW+Q++ Sbjct: 923 KWQHKSQDTTEVTKYILQYKEGDAGIWQQQE 953 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 2.3 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 318 RSTRGCRRLSRYSPTQGGPVPATFASS 238 R+ R +RYS T+ V AT ASS Sbjct: 911 RNVRQSMMPTRYSTTKSSAVTATNASS 937 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.4 bits (43), Expect = 4.0 Identities = 11/44 (25%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 122 TWGSNDSSEKRHTWYLYPVKVGDQQL--FLIENREYRQGLKLDA 247 +W NDS H ++ + + G+ + F + ++ GL L A Sbjct: 203 SWAKNDSWRITHNFFYFDPRYGNYNINGFNFQWKDGLFGLSLSA 246 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 4.0 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -1 Query: 386 SDKVYYNMVRCRRVSLP 336 S K+YYN++ ++ +P Sbjct: 320 SKKLYYNIINIEQIPVP 336 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 4.0 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -1 Query: 386 SDKVYYNMVRCRRVSLP 336 S K+YYN++ ++ +P Sbjct: 331 SKKLYYNIINIEQIPVP 347 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 46 LQDTEHRTRDVLETGRERG 102 LQD E+ R + T RERG Sbjct: 468 LQDREYCPRYIKWTNRERG 486 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 20.6 bits (41), Expect = 7.0 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 192 WSPTFTGYKYQVCLFSLESFDPQVF 118 W P F ++ + +SFDP+ F Sbjct: 397 WIPAFAIHRDSAIYPNPDSFDPERF 421 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 9.3 Identities = 5/15 (33%), Positives = 11/15 (73%) Frame = -1 Query: 380 KVYYNMVRCRRVSLP 336 K+YYN++ ++ +P Sbjct: 111 KLYYNIINIEQIPVP 125 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 9.3 Identities = 5/15 (33%), Positives = 11/15 (73%) Frame = -1 Query: 380 KVYYNMVRCRRVSLP 336 K+YYN++ ++ +P Sbjct: 111 KLYYNIINIEQIPVP 125 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.2 bits (40), Expect = 9.3 Identities = 5/15 (33%), Positives = 11/15 (73%) Frame = -1 Query: 380 KVYYNMVRCRRVSLP 336 K+YYN++ ++ +P Sbjct: 331 KLYYNIINIEQIPVP 345 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 20.2 bits (40), Expect = 9.3 Identities = 5/15 (33%), Positives = 11/15 (73%) Frame = -1 Query: 380 KVYYNMVRCRRVSLP 336 K+YYN++ ++ +P Sbjct: 351 KLYYNIINIEQIPVP 365 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.2 bits (40), Expect = 9.3 Identities = 5/15 (33%), Positives = 11/15 (73%) Frame = -1 Query: 380 KVYYNMVRCRRVSLP 336 K+YYN++ ++ +P Sbjct: 335 KLYYNIINIEQIPVP 349 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 20.2 bits (40), Expect = 9.3 Identities = 5/15 (33%), Positives = 11/15 (73%) Frame = -1 Query: 380 KVYYNMVRCRRVSLP 336 K+YYN++ ++ +P Sbjct: 353 KLYYNIINIEQIPVP 367 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 20.2 bits (40), Expect = 9.3 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 243 SSFRPCRYSLFS 208 S+ PC Y+LFS Sbjct: 55 SAINPCIYALFS 66 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.2 bits (40), Expect = 9.3 Identities = 9/37 (24%), Positives = 16/37 (43%) Frame = -1 Query: 287 VIPPHKAVPYRPRSRPASGPAGTPYSQ*GTAVGRPPS 177 ++PPH A + R+R Y++ G P+ Sbjct: 760 ILPPHVAAYFLSRARHHDDLYSQSYAEVGVLFASMPN 796 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 203 GTAVGRPPSPGINTRC 156 G+ G P SP N+RC Sbjct: 317 GSNNGSPRSPESNSRC 332 Score = 20.2 bits (40), Expect = 9.3 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 243 SSFRPCRYSLFS 208 S+ PC Y+LFS Sbjct: 503 SAINPCIYALFS 514 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,505 Number of Sequences: 438 Number of extensions: 3188 Number of successful extensions: 23 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10132494 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -